Sequence:
download
CE28953sequence.fasta
>APN-1 MANKKVTFREDVKSPAIRKLKQKLTPLKIKKGRGKIQKHIQKTLQKMKEEEESENQSPGTTVEETLTEENISTDKEETSK LENKPKKTRKTSGETIAQKKSRETVGVEVLKTSEGSSKMLGFHVSAAGGLEQAIYNARAEGCRSFAMFVRNQRTWNHKPM SEEVVENWWKAVRETNFPLDQIVPHGSYLMNAGSPEAEKLEKSRLAMLDECQRAEKLGITMYNFHPGSTVGKCEKEECMT TIAETIDFVVEKTENIILVLETMAGQGNSIGGTFEELKFIIDKVKVKSRVGVCIDTCHIFAGGYDIRTQKAYEEVMKNFG EVVGWNYLKAIHINDSKGDVGSKLDRHEHIGQGKIGKAAFELLMNDNRLDGIPMILETPEGKYPEEMMIMYNMDKR
view sequence (396 aa)
>APN-1
MANKKVTFREDVKSPAIRKLKQKLTPLKIKKGRGKIQKHIQKTLQKMKEEEESENQSPGTTVEETLTEENISTDKEETSK
LENKPKKTRKTSGETIAQKKSRETVGVEVLKTSEGSSKMLGFHVSAAGGLEQAIYNARAEGCRSFAMFVRNQRTWNHKPM
SEEVVENWWKAVRETNFPLDQIVPHGSYLMNAGSPEAEKLEKSRLAMLDECQRAEKLGITMYNFHPGSTVGKCEKEECMT
TIAETIDFVVEKTENIILVLETMAGQGNSIGGTFEELKFIIDKVKVKSRVGVCIDTCHIFAGGYDIRTQKAYEEVMKNFG
EVVGWNYLKAIHINDSKGDVGSKLDRHEHIGQGKIGKAAFELLMNDNRLDGIPMILETPEGKYPEEMMIMYNMDKR
Estimated Isoelectric Point:
8.04167938232422
Estimated Molecular Weight:
44.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys45
Gln13
Leu24
Gly31
Met17
Ser21
Tyr8
His9
Glu46
Arg17
Cys6
Phe12
Pro12
Val24
Asn19
Ala21
Ile26
Trp4
Asp14