Sequence:
download
CE28763sequence.fasta
>GES-1 MRIFLVSVILINACWAGPIVETNYGKVEGIEYEGAEVFLAIPFAKPPVDDLRFEKPVAPDPWEDVYPATQYRNDCTPHYR LVAQFSSYSGEDCLTLNIIKPKKAEKLPVLFWIHGGGYEIGSASQHGYEFFAKRYASQGVIVATVQYRLGFMGFFSEGTS DVQGNWGLFDQAAALEFVKSNIENFGGDPNQITIWGYSAGAASVSQLTMSPYTRDSYSKAIIMSASSFVGWATGPNVVET SKQLAEILGCPWPGAKECMKKKSLHEIFDAIEVQGWTTGTIDILRWSPVIDGDFMTKNPEELIKESPVKPTLIGMSNKEG SYFAALNMGRVIADFGLSPEDMPKVDEEFISEIIGRKLLYNNRYGENREKVWNDILDFYVKQGKPAEVKDLNGFYVDRYS ELLSDITFNVPILREITSRVERKTPVWTYRMDHYDKNIWKKHIPEQARGSPHANEYHYLFDMPVMAKIDMKKEPDSWIQN DLIDMVISFAKTGVPQIEDVEWRPVSDPDDVNFLNIRSDGVSIEHGLFQEPLAFWNELRQREGFDLIDPTNSAMHSSNKD EL
view sequence (562 aa)
>GES-1
MRIFLVSVILINACWAGPIVETNYGKVEGIEYEGAEVFLAIPFAKPPVDDLRFEKPVAPDPWEDVYPATQYRNDCTPHYR
LVAQFSSYSGEDCLTLNIIKPKKAEKLPVLFWIHGGGYEIGSASQHGYEFFAKRYASQGVIVATVQYRLGFMGFFSEGTS
DVQGNWGLFDQAAALEFVKSNIENFGGDPNQITIWGYSAGAASVSQLTMSPYTRDSYSKAIIMSASSFVGWATGPNVVET
SKQLAEILGCPWPGAKECMKKKSLHEIFDAIEVQGWTTGTIDILRWSPVIDGDFMTKNPEELIKESPVKPTLIGMSNKEG
SYFAALNMGRVIADFGLSPEDMPKVDEEFISEIIGRKLLYNNRYGENREKVWNDILDFYVKQGKPAEVKDLNGFYVDRYS
ELLSDITFNVPILREITSRVERKTPVWTYRMDHYDKNIWKKHIPEQARGSPHANEYHYLFDMPVMAKIDMKKEPDSWIQN
DLIDMVISFAKTGVPQIEDVEWRPVSDPDDVNFLNIRSDGVSIEHGLFQEPLAFWNELRQREGFDLIDPTNSAMHSSNKD
EL
Estimated Isoelectric Point:
4.93752288818359
Estimated Molecular Weight:
63.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys34
Gln17
Leu36
Gly40
Met15
Ser39
Tyr23
His10
Glu43
Arg22
Cys5
Phe29
Pro34
Val38
Asn26
Ala35
Ile42
Trp15
Asp37