Sequence:
download
CE28597sequence.fasta
>RNP-2 MAEVAPNSTLYINNLNEKIKIDELRKSLVAVFKQFGEIVSVMCFRTLKMRGQAHVIFKELPAASAAREALNGFPFYEKPM RIQFAREDSDVVAQEKGTYIKREPKYLSEKILKKPKSRKKENGGDGPAPPNKILFCTNLPDSATAEMLEIMFNQFAGLKD IRMVPNRPGIAFVEFDTDSLAIPARTTLNNFKISAEHTMRVDYAKK
view sequence (206 aa)
>RNP-2
MAEVAPNSTLYINNLNEKIKIDELRKSLVAVFKQFGEIVSVMCFRTLKMRGQAHVIFKELPAASAAREALNGFPFYEKPM
RIQFAREDSDVVAQEKGTYIKREPKYLSEKILKKPKSRKKENGGDGPAPPNKILFCTNLPDSATAEMLEIMFNQFAGLKD
IRMVPNRPGIAFVEFDTDSLAIPARTTLNNFKISAEHTMRVDYAKK
Estimated Isoelectric Point:
9.43001556396484
Estimated Molecular Weight:
23.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys21
Gln5
Leu15
Gly9
Met8
Ser10
Tyr5
His2
Glu16
Arg12
Cys2
Phe13
Pro13
Val11
Asn12
Ala20
Ile14
Asp9