Sequence:
download
CE28465sequence.fasta
>CDO-1 MISFVQLVVQIREIFQQKLIDVDEVMKLMASYKSNANEWRRFAIFDMNKYTRNLVDVGNGKYNLMILCWGPGMASSVHDH TDAHCFVKILDGELTETKYAWPRKRHVPLDISENKTYGMNGVSYMNDELGLHRMENLSHSNGAVSLHLYIPPYSTCNAFD ERTGKKTQCTVTFYSKYGKKVDYRGSKNGN
view sequence (190 aa)
>CDO-1
MISFVQLVVQIREIFQQKLIDVDEVMKLMASYKSNANEWRRFAIFDMNKYTRNLVDVGNGKYNLMILCWGPGMASSVHDH
TDAHCFVKILDGELTETKYAWPRKRHVPLDISENKTYGMNGVSYMNDELGLHRMENLSHSNGAVSLHLYIPPYSTCNAFD
ERTGKKTQCTVTFYSKYGKKVDYRGSKNGN
Estimated Isoelectric Point:
8.78743743896484
Estimated Molecular Weight:
21.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys15
Gln5
Leu14
Gly13
Met9
Ser13
Tyr11
His7
Glu9
Arg9
Cys4
Phe7
Pro5
Val14
Asn14
Ala8
Ile9
Trp3
Asp11