Sequence:
download
CE28405sequence.fasta
>PRP-17 MDALQAYGGSDSEHSDDDASMDQVAKGKSSTLLERAIVTAPDVESKSAIRQVAIVDPKTKEIKSNPKFDQLFKPESGPVN HFKSEQQRSQKNTLTGFVEPAHLNEFHFNRQIRSFDTLGYAQNPTAESGTTHFVGDVKKAEAEKGVSLFESKKTGGEKRK RVRNDDSADIDGYTGPWSRFIDEKTVAKPTPELQKQMDEIVKKRQEKSRRFKKEKEDSEQMAEESSTLHLKEAEDYQGRS FLVPPSFTGVNLREDYVPERCFVPKKLVHTYRGHNKGVNFLQWFPKSAHLFLSCSMDTKIKLWEVYDRQRVVRTYAGHKL PVREVAFNNEGTEFLSASFDRYVKLWDTETGQVKQRFHTGHVPYCLKYHPDDDKNHMFLVGMQNKKIIQWDSRSGEIVQE YDRHLQAVNSITFFDKNRRFASTSDDKSVRIWEWEIPVDTKLIQNVGLHAIPTMTKSPNDKWVVGQCMDNRIVLFQLVDD KLRFSKKKAFRGHNAAGYACNIDFSPDQSFLISGDADGKLFIWDWRTHKIVGKWKAHDSTCIAALWHPHEKSRMITAGWD GLIKMWN
view sequence (567 aa)
>PRP-17
MDALQAYGGSDSEHSDDDASMDQVAKGKSSTLLERAIVTAPDVESKSAIRQVAIVDPKTKEIKSNPKFDQLFKPESGPVN
HFKSEQQRSQKNTLTGFVEPAHLNEFHFNRQIRSFDTLGYAQNPTAESGTTHFVGDVKKAEAEKGVSLFESKKTGGEKRK
RVRNDDSADIDGYTGPWSRFIDEKTVAKPTPELQKQMDEIVKKRQEKSRRFKKEKEDSEQMAEESSTLHLKEAEDYQGRS
FLVPPSFTGVNLREDYVPERCFVPKKLVHTYRGHNKGVNFLQWFPKSAHLFLSCSMDTKIKLWEVYDRQRVVRTYAGHKL
PVREVAFNNEGTEFLSASFDRYVKLWDTETGQVKQRFHTGHVPYCLKYHPDDDKNHMFLVGMQNKKIIQWDSRSGEIVQE
YDRHLQAVNSITFFDKNRRFASTSDDKSVRIWEWEIPVDTKLIQNVGLHAIPTMTKSPNDKWVVGQCMDNRIVLFQLVDD
KLRFSKKKAFRGHNAAGYACNIDFSPDQSFLISGDADGKLFIWDWRTHKIVGKWKAHDSTCIAALWHPHEKSRMITAGWD
GLIKMWN
Estimated Isoelectric Point:
8.77248382568359
Estimated Molecular Weight:
65.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys55
Gln26
Leu33
Gly32
Met11
Ser42
Tyr13
His21
Glu36
Arg32
Cys6
Phe31
Pro23
Val38
Asn22
Ala33
Ile25
Trp14
Asp44