Sequence:
download
CE28363sequence.fasta
>ACE-2 MRAPVIGRHLTYHVFCQFALVTLFIVRRIEPRSIVRGDHVVHTPLGTIRGVGQTFDGAKVSAFLGVPYAKPPIGSRRFKM AEMIDRWSGELEARTLAKTCYLTIDSAFPQFPGAEMWNPPGAISEDCLNMNIWVPEDHDGSVMVWIYGGGFFSGTPSLDL YSGSVFAAKEHTIVVNVNYRLGPFGFLYFGDDSPIQGNMGLMDQQLALRWVHENIGAFGGDRSRVTLFGESAGSASTTAH LFAPNSHKYFRNIIAKSGSIINSWASATPPTMLDLSFRLAKKVNCSSPDMNAIVKCLRSVPAHLVQAEADNISGDIGPPM TFAYVPVSSDANFFQGDVFQKLANKQFKKDVNIIFGSVKDEGTYWLPYYMSLPKYGFAFNHTISAEDPHNRALITRDHYE ESMRAFMPYFAGSKLVLNAFMNSYEHVSTSNVPEERYRDGVARFLGDLFFTCSLIDFADLISDNIFGNVYMYYFTYRSSA NPWPKWMGVMHGYEIEYAFGQPYWRPHLYDQTHLEDEKRLSSIIMQIWANFANTGRTDSFWPQYNKIERKAIELGETTLQ GKHRIISDVHGGFCRMIDEAKAFVKQKNANDCRTTRKSASTEDLTSSSSTTYLFSIIVYLSILISYISL
view sequence (629 aa)
>ACE-2
MRAPVIGRHLTYHVFCQFALVTLFIVRRIEPRSIVRGDHVVHTPLGTIRGVGQTFDGAKVSAFLGVPYAKPPIGSRRFKM
AEMIDRWSGELEARTLAKTCYLTIDSAFPQFPGAEMWNPPGAISEDCLNMNIWVPEDHDGSVMVWIYGGGFFSGTPSLDL
YSGSVFAAKEHTIVVNVNYRLGPFGFLYFGDDSPIQGNMGLMDQQLALRWVHENIGAFGGDRSRVTLFGESAGSASTTAH
LFAPNSHKYFRNIIAKSGSIINSWASATPPTMLDLSFRLAKKVNCSSPDMNAIVKCLRSVPAHLVQAEADNISGDIGPPM
TFAYVPVSSDANFFQGDVFQKLANKQFKKDVNIIFGSVKDEGTYWLPYYMSLPKYGFAFNHTISAEDPHNRALITRDHYE
ESMRAFMPYFAGSKLVLNAFMNSYEHVSTSNVPEERYRDGVARFLGDLFFTCSLIDFADLISDNIFGNVYMYYFTYRSSA
NPWPKWMGVMHGYEIEYAFGQPYWRPHLYDQTHLEDEKRLSSIIMQIWANFANTGRTDSFWPQYNKIERKAIELGETTLQ
GKHRIISDVHGGFCRMIDEAKAFVKQKNANDCRTTRKSASTEDLTSSSSTTYLFSIIVYLSILISYISL
Estimated Isoelectric Point:
6.83449554443359
Estimated Molecular Weight:
70.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr33
Lys26
Gln16
Leu43
Gly46
Met20
Ser54
Tyr29
His19
Glu27
Arg33
Cys8
Phe42
Pro32
Val37
Asn29
Ala47
Ile42
Trp12
Asp34