Sequence:
download
CE28361sequence.fasta
>OSM-5 MANSTFREDDDDFYGGFDSYDKAYDIQNITQNPQFQQAVARSSHGRRPTASQMGFRDASSSYGKPPGTMMGNQSRMGGRT AMANNNEPARPMTAVRGAGYTSFANKVQAAERPLSTENSGENGEEKCRQMENKVMEMLRESMLASEKKKFKEALDKAKEA GRRERAVVKHREQQGLVEMMNLDLTFTVLFNLAQQYEANDMTNEALNTYEIIVRNKMFPNSGRLKVNIGNIHFRKREFTK ALKYYRMALDQVPSIQKDTRIKILNNIGVTFVRMGSYDDAISTFDHCVEENPNFITALNLILVAFCIQDAEKMREAFVKM IDIPGFPDDDYMKEKDDDDVLLNQTLNSDMLKNWEKRNKSDAEKAIITAVKIISPVIAPDYAIGYEWCLESLKQSVHAPL AIELEMTKAGELMKNGDIEGAIEVLKVFNSQDSKTASAAANNLCMLRFLQGGRRLVDAQQYADQALSIDRYNAHAQVNQG NIAYMNGDLDKALNNYREALNNDASCVQALFNIGLTAKAQGNLEQALEFFYKLHGILLNNVQVLVQLASIYESLEDSAQA IELYSQANSLVPNDPAILSKLADLYDQEGDKSQAFQCHYDSYRYFPSNLETVEWLASYYLETQFSEKSINYLEKAALMQP NVSKWQMMIASCLRRTGNYQRAFELYRQIHRKFPQDLDCLKFLVRIAGDLGMTEYKEYKDKLEKAEKINQLRLQRESDSS QGKRHSANSTHSLPPSGLTGLGSGSGGSSGGGTRQYSAHVPLLLDSGTPFTVAQRDMKAEDFSYDDPVAISSRPKTGTRK TTTDTNIDDFGDFDDSLLPD
view sequence (820 aa)
>OSM-5
MANSTFREDDDDFYGGFDSYDKAYDIQNITQNPQFQQAVARSSHGRRPTASQMGFRDASSSYGKPPGTMMGNQSRMGGRT
AMANNNEPARPMTAVRGAGYTSFANKVQAAERPLSTENSGENGEEKCRQMENKVMEMLRESMLASEKKKFKEALDKAKEA
GRRERAVVKHREQQGLVEMMNLDLTFTVLFNLAQQYEANDMTNEALNTYEIIVRNKMFPNSGRLKVNIGNIHFRKREFTK
ALKYYRMALDQVPSIQKDTRIKILNNIGVTFVRMGSYDDAISTFDHCVEENPNFITALNLILVAFCIQDAEKMREAFVKM
IDIPGFPDDDYMKEKDDDDVLLNQTLNSDMLKNWEKRNKSDAEKAIITAVKIISPVIAPDYAIGYEWCLESLKQSVHAPL
AIELEMTKAGELMKNGDIEGAIEVLKVFNSQDSKTASAAANNLCMLRFLQGGRRLVDAQQYADQALSIDRYNAHAQVNQG
NIAYMNGDLDKALNNYREALNNDASCVQALFNIGLTAKAQGNLEQALEFFYKLHGILLNNVQVLVQLASIYESLEDSAQA
IELYSQANSLVPNDPAILSKLADLYDQEGDKSQAFQCHYDSYRYFPSNLETVEWLASYYLETQFSEKSINYLEKAALMQP
NVSKWQMMIASCLRRTGNYQRAFELYRQIHRKFPQDLDCLKFLVRIAGDLGMTEYKEYKDKLEKAEKINQLRLQRESDSS
QGKRHSANSTHSLPPSGLTGLGSGSGGSSGGGTRQYSAHVPLLLDSGTPFTVAQRDMKAEDFSYDDPVAISSRPKTGTRK
TTTDTNIDDFGDFDDSLLPD
Estimated Isoelectric Point:
5.46623992919922
Estimated Molecular Weight:
92.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr37
Lys52
Gln46
Leu72
Gly48
Met30
Ser59
Tyr33
His12
Glu53
Arg44
Cys9
Phe33
Pro27
Val35
Asn54
Ala74
Ile39
Trp4
Asp59