Sequence:
download
CE28345sequence.fasta
>ACR-3 MQKIWLFSIITIFLITELQCYPNSAEERLLSYIFDGYNSLIRPVLNASSPPIEVFFSLAFVLLINVDEKNQIMQTNVWPT MKWNDYQMQWDPREFDGIKTIRVPPDKVWLPDIVLFNNADGNYLVSFYSNVVVEHTGDMLWVPPAVYKSSCLIDVEFFPF DEQVCSLTFGSWTFRKDELQLSYLSGKRHVELNDYLPSGVWDLIDAPGLLIDERSKISYQIKIRRKALFYTVILIMPTVL MAFLSMMVFYLPAESSEKITLAISILLALVVFLLVVSKILPPTSSTIPLMAKYLLMTFIMNMITIMVSVIIINVYFRGPA THIMPNWVKTVFLKFLPVLFVMRRPESTEKELAKMKREKRERRSMKSALKTFFKRNDAKISEQPKQTSRKDGSSSEEKLS SDAKKAIEAIEYITTHLTHDNAFKRQREEWKFVSVVIDRLLLYLFFAVTTGGTVGILLSAPNVFEQVNQTSVIERLKQQA AEEMLNS
view sequence (487 aa)
>ACR-3
MQKIWLFSIITIFLITELQCYPNSAEERLLSYIFDGYNSLIRPVLNASSPPIEVFFSLAFVLLINVDEKNQIMQTNVWPT
MKWNDYQMQWDPREFDGIKTIRVPPDKVWLPDIVLFNNADGNYLVSFYSNVVVEHTGDMLWVPPAVYKSSCLIDVEFFPF
DEQVCSLTFGSWTFRKDELQLSYLSGKRHVELNDYLPSGVWDLIDAPGLLIDERSKISYQIKIRRKALFYTVILIMPTVL
MAFLSMMVFYLPAESSEKITLAISILLALVVFLLVVSKILPPTSSTIPLMAKYLLMTFIMNMITIMVSVIIINVYFRGPA
THIMPNWVKTVFLKFLPVLFVMRRPESTEKELAKMKREKRERRSMKSALKTFFKRNDAKISEQPKQTSRKDGSSSEEKLS
SDAKKAIEAIEYITTHLTHDNAFKRQREEWKFVSVVIDRLLLYLFFAVTTGGTVGILLSAPNVFEQVNQTSVIERLKQQA
AEEMLNS
Estimated Isoelectric Point:
8.46689605712891
Estimated Molecular Weight:
56.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys32
Gln16
Leu54
Gly13
Met19
Ser40
Tyr16
His5
Glu30
Arg22
Cys3
Phe30
Pro25
Val40
Asn20
Ala24
Ile40
Trp10
Asp21