Sequence:
download
CE28212sequence.fasta
>MDF-1 MNYDEDIVDEDEYEESEATMLFAEEIKKQFKREFPLKAETEKKLKQATFRRHAPVEARKINFDMTLSPVAPIELASAKKE KESAQRQLVTLREDHERMKQMMQTNQAKLAEKTIDLETNREKMLELQEQVELLKQERDDTIAECNRNVDIWTAFGKKYYT WYSMANTQLESVKLYIDNDGKFENDEEVTRLNAVPRQMYRALEQFDYDDETVEELGSGSLLEYEGVSFATRRPPSPETER EIARADQSAANFTLPQSNFTLLEDSNNTIMPEDQTMMTDGCIANRSLIDYEKDEKIQRLLLENSVLKDRLNVSSGRAERS MIFEERNRTLEFEKKALHKQLDSTFSEIEAIRIGQAGNLFNIDEKIPSSSDNSAKQLQLIDRITQLITKNNQLEKDFEAA TSRMTKVMRESTDCARRNERLEDAFSSERVRSQDLENEKSRLSEQLELSNNELEKVKKQLEESQSQLDEVLSMTLTVPAS EPASLPAPTDAGNSTQIFHMASNPLQDAHNEFQASESRKRKLTDAPAGDQWREQEFAELEKRLYDCESEKKVLESSYNLH KELSSKFRQVCIALTGLQIKLKDADEGICTVQSEYEGGSAQQFVFKYFYGTPRIDMLDVSCESTTEMLRKWEPLMKKYIG DRNSIPAFLAAMTLQLEQDRDFDETMHERTHTFSVLHED
view sequence (679 aa)
>MDF-1
MNYDEDIVDEDEYEESEATMLFAEEIKKQFKREFPLKAETEKKLKQATFRRHAPVEARKINFDMTLSPVAPIELASAKKE
KESAQRQLVTLREDHERMKQMMQTNQAKLAEKTIDLETNREKMLELQEQVELLKQERDDTIAECNRNVDIWTAFGKKYYT
WYSMANTQLESVKLYIDNDGKFENDEEVTRLNAVPRQMYRALEQFDYDDETVEELGSGSLLEYEGVSFATRRPPSPETER
EIARADQSAANFTLPQSNFTLLEDSNNTIMPEDQTMMTDGCIANRSLIDYEKDEKIQRLLLENSVLKDRLNVSSGRAERS
MIFEERNRTLEFEKKALHKQLDSTFSEIEAIRIGQAGNLFNIDEKIPSSSDNSAKQLQLIDRITQLITKNNQLEKDFEAA
TSRMTKVMRESTDCARRNERLEDAFSSERVRSQDLENEKSRLSEQLELSNNELEKVKKQLEESQSQLDEVLSMTLTVPAS
EPASLPAPTDAGNSTQIFHMASNPLQDAHNEFQASESRKRKLTDAPAGDQWREQEFAELEKRLYDCESEKKVLESSYNLH
KELSSKFRQVCIALTGLQIKLKDADEGICTVQSEYEGGSAQQFVFKYFYGTPRIDMLDVSCESTTEMLRKWEPLMKKYIG
DRNSIPAFLAAMTLQLEQDRDFDETMHERTHTFSVLHED
Estimated Isoelectric Point:
4.82270050048828
Estimated Molecular Weight:
78.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr42
Lys48
Gln40
Leu65
Gly17
Met22
Ser52
Tyr16
His9
Glu87
Arg44
Cys7
Phe27
Pro20
Val24
Asn32
Ala48
Ile29
Trp4
Asp46