Sequence:
download
CE28131sequence.fasta
>ACE-3 MRRRRVLLLLLSTTTFLRVSTAQQDEPKASVVEVQTKLGTVRGTESDHGNKRVRSFLGVPFAEPPINEHRFKKPTPARPW NGTISANTLSPACFQGRDSYDPTFWGSEMWNANTPVSEDCLYVNIWAPADAYNLTVLVWLFGGGFWYGSPSLLLYDGKEL ATRGNVIVVNINYRVGPFGYLFLDHEDVPGNMGMLDQQLALYWIRDHIFSFGGNPARISLVGESAGAASIVAHLIAPASK GLFQNGILQSGSLDNKWSMDSPKRAKQKSTALADLVGCNQTKITDQTACLRNTPAQLLIDNIWNVGLNFLEFPFAIVSKD QNFFKHLDGFIALREGTYSTDVNLMFGINHDEGNFWNIYNLAKFFDKQSVKPGLDRDEFHECVDTAFAVQPELVRTAAKY VYSDPKCTDPKKKTDFYTEQVNQMVGDYFFTCDSIWFAHNYPKMAGNQSNVFVYYFDQPSSANPWPKWTGVMHGYEIEYV FGVPLHNTTAGYTKEEMDVSEKVIDFWTTFANTGVPSLRKRAVGTTQKIKWDRYDGTDHTTWMNIKTGSFRMIQEIKKVE CDLWRNAKDMEYSAYKEELATTSSSTLTQYTIYLILLSAFQLVFNFF
view sequence (607 aa)
>ACE-3
MRRRRVLLLLLSTTTFLRVSTAQQDEPKASVVEVQTKLGTVRGTESDHGNKRVRSFLGVPFAEPPINEHRFKKPTPARPW
NGTISANTLSPACFQGRDSYDPTFWGSEMWNANTPVSEDCLYVNIWAPADAYNLTVLVWLFGGGFWYGSPSLLLYDGKEL
ATRGNVIVVNINYRVGPFGYLFLDHEDVPGNMGMLDQQLALYWIRDHIFSFGGNPARISLVGESAGAASIVAHLIAPASK
GLFQNGILQSGSLDNKWSMDSPKRAKQKSTALADLVGCNQTKITDQTACLRNTPAQLLIDNIWNVGLNFLEFPFAIVSKD
QNFFKHLDGFIALREGTYSTDVNLMFGINHDEGNFWNIYNLAKFFDKQSVKPGLDRDEFHECVDTAFAVQPELVRTAAKY
VYSDPKCTDPKKKTDFYTEQVNQMVGDYFFTCDSIWFAHNYPKMAGNQSNVFVYYFDQPSSANPWPKWTGVMHGYEIEYV
FGVPLHNTTAGYTKEEMDVSEKVIDFWTTFANTGVPSLRKRAVGTTQKIKWDRYDGTDHTTWMNIKTGSFRMIQEIKKVE
CDLWRNAKDMEYSAYKEELATTSSSTLTQYTIYLILLSAFQLVFNFF
Estimated Isoelectric Point:
6.21028900146484
Estimated Molecular Weight:
68.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr45
Lys34
Gln23
Leu49
Gly41
Met13
Ser38
Tyr25
His12
Glu27
Arg25
Cys8
Phe39
Pro29
Val41
Asn36
Ala41
Ile27
Trp17
Asp37