Sequence:
download
CE28078sequence.fasta
>ACR-7 MMVQSIQIVLPVALFFLIVFNGFTVEGSKKEAQLYRDLLTNYSYLVRPVRNPKKALTVTMKVFIQQVLLVDAKHQMIEVN AWLKYIWTDFRLRWNPLDYENITSVRFQGEDQIWQPDILLYNRYIEDEQESFDITYKTNAVAYSDGVINWIPPGIFKLSC KMDITLFPFDEQICFMKFGSWTYHGFALDLRLDVVKGQEPSADLSTYITNGEWHLLSAPARREEKFYKCCKEPYPTVKFY LHLRRRTFYYVFNVVLPTLLVSFMSLLAFCLPATDLSEKIGLQTTILLSVCFFLTILSEMTPTTSEAVPLLGVFFSALTF IVAMSTTFTILVLNIRYRQITNHYLSPMFRSIFLECLPWLMMMKRPDHKFRRGSSYRDSSADQCVQCAKNAELKSILRGT DNQQQIETNTFYPFPTETLSLNRKVGDGLFIQRRCQIHEEARSEKFTHGMLACEKSLRENGSELANILVTILKMYEVMVS QVERIRKRIALKRKRKDIQDEWKFAAQAVDRFCLIIFTIVFIICCFIFVAIPPIKILD
view sequence (538 aa)
>ACR-7
MMVQSIQIVLPVALFFLIVFNGFTVEGSKKEAQLYRDLLTNYSYLVRPVRNPKKALTVTMKVFIQQVLLVDAKHQMIEVN
AWLKYIWTDFRLRWNPLDYENITSVRFQGEDQIWQPDILLYNRYIEDEQESFDITYKTNAVAYSDGVINWIPPGIFKLSC
KMDITLFPFDEQICFMKFGSWTYHGFALDLRLDVVKGQEPSADLSTYITNGEWHLLSAPARREEKFYKCCKEPYPTVKFY
LHLRRRTFYYVFNVVLPTLLVSFMSLLAFCLPATDLSEKIGLQTTILLSVCFFLTILSEMTPTTSEAVPLLGVFFSALTF
IVAMSTTFTILVLNIRYRQITNHYLSPMFRSIFLECLPWLMMMKRPDHKFRRGSSYRDSSADQCVQCAKNAELKSILRGT
DNQQQIETNTFYPFPTETLSLNRKVGDGLFIQRRCQIHEEARSEKFTHGMLACEKSLRENGSELANILVTILKMYEVMVS
QVERIRKRIALKRKRKDIQDEWKFAAQAVDRFCLIIFTIVFIICCFIFVAIPPIKILD
Estimated Isoelectric Point:
8.76511383056641
Estimated Molecular Weight:
62.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys31
Gln24
Leu59
Gly17
Met16
Ser31
Tyr21
His8
Glu30
Arg32
Cys14
Phe39
Pro23
Val36
Asn19
Ala27
Ile43
Trp9
Asp24