Sequence:
download
CE28018sequence.fasta
>ITR-1, isoform f MDYDYRRRVLERNIGMALPSRKLTIANSIDHGNNGNLHIGDIISLYTESSSNQEQRGFLSTLGLVDDRCIVELKDGRPES PPKKFRDCLFKVCPVNRYAAQKHLWTEQKRFQTGDSMFDDDLMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHV KSNKYITVQKNSPAKRERNAMKVYLDRAGNEGSWFIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLSSF NLLDHQSAAEVNCLNEPTEWQVFMFLLFDENQQNSVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMTNRPSAAD ATSSRALWEVQVVQTNAYRGGTAKWNKAYRFKHLATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVT NESTDTTQQNIPSVWVLGPTKSEFPEEDANLLFQLDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSK NEKGWVKVICEKNRVDKETFALLPVNPDEVRDLDFANDACKALRNFIKLIKIGQVISKESINSTTQLLIDCILFVTNSSD HLADPLKISDFSPSRDRQKLLREQEVLNQVFLLLKAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCYCLLKYSQ VSYRKNQEFLAEKFGEIQEQIGFDLMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEA NKKIQELICTSVLSSKHRDIFMDTKIIDGEIEVGWAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLA IDPPPERRLMNISQQLPAELVLQCMSDNRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVE AYSDGSRMRIGEGIAHKVLATVETYLMGLRNQSMEERQSVNSSKLTYEIVNLAKALAQFNFYSFNDLLQLTQNLLAIINE GPATEQVPSHRAMVNAIRNMSKSMMRGGNKENSKDLAKTPSVTAEEAGRTKEGRALNVKTKLIVAEILQFVMDVRRDYRI TMALSWFKNVFPCDEDGSLMHSASINERMASELYDAIYRSSGHELHLDGRDGQLLLAILLQMTMSDYPPLTSIALKVFFR HFTQYQELLEDLKQVQLLVSNNDVENYRQIDRDLFILKNLTEKSELWVHGDRHHSIDTKEVDEKERTTEHDLLDHDLKSP RAFDSGDSMEALMAVLNEHYPSIRNECLQLLNRLLIKDDRNDAAVALQELSDKAPLIAYPLIRQMLVRLTGMCYRKGDPK PDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHDMMKLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIE EVGTLVAIFRNNRELASNVPEELIAHIVGLIEHNSRNPIFLELLQALVCVYDKEIESGQEKVANEICAASDEVRQLYVDN ASFEELEAMMKDEKESKGRSSDSRRKLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQ LLLHCYIDTDAEMKDAYKTEYVDHILNNLLEDIRSLRVEKLTGAETATLEHYICHTVTEVLIKFFEAPYSALQQAKVDVH HHKKTFSEVLLELTYLEKGKLRGSKSSRNWYRVAECIKRLTKWAEEHNITLPATLAGPQMSGQTSVRQKWQQAASSAKWI GIGKRLNRQNTLNPGHRLYGTSNSMTEHTSANVVTCYHMMIGEFKFYLHPLHAAEGSVLVEVLHTPELLFPEGSALRDQC ARGGVVAKLIQHCKTLMQNKQDNLCARVLQTLCKMCDCTKQQLTHQGQQLRQLLLQRYFGHHNNHHPPLDRQQSKIGEVI EAVKEKKEETWSQERDLYAIQCKLNDAGASDLVTDIIIMEPSREIFLKAIHLARALLHEGNDKVQHSFYMRMKQKDIHEP FFKAILTRIQTAQNRLKSDMMSCSDSKPKVSLSATVSRRSSTVLTPLIDAGDTGFNGALFEVPQQVRHPSISEMSQLSND LTHSIPDLAPYQDEEKSTDALPPEVALVEPILRVLQLLCENHNSLLQNFLRKQSDRTNHNLVSETLSFLDTVCGSTKGSL GVFGEIGEHNFSLITQTLATLTEFCQGPCHENQNTMAMQENGLNIIISLVLNEIKPLADDHMELALEIKSQASKLLLAIM ESRHDGENANRVLRNMANMSGGPKQLVHAIKQAYEMTNSNHHMLKSISRDLFRQAEDDLKKKSGPQITVNTVTLPEINVD ASGIVSIHTEKNISSSLDDKFNDDDIPSVDPREVGHNIYILAHQLAIHDGELEIWLDGSDEKKDDLTREALNYYKERTAQ IEIVRRDRTLERVVFPINDICSYLTKDTKDYVYNNTERDNQGSKVTEFFDEWETMYHEMIWQRKLQDRKWLSWCAFRLPL WTRLSFHFAFIVNALVARYYPLPEHSNSSISLGNLYSWFAVFSSFLLAHYLRHDKIYLHKTSLLILASLCFLLLSSIGVT LTLYIFGILQLVNKIVHVVAFVSNKGLEDRPIAEILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVI ASVTRNYQSIVWTGLLALILLYFFSILGFLYFRHDFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEK KVKSCETLWMCILQTGYQGLRNGGGIGDVLRNPAPWEDMFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEK EQILKNNCFICGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSL QDSELDTDQSEVKQMKDQLLQMMTLMREIISQNEESRAFMEQFQPR
view sequence (2846 aa)
>ITR-1, isoform f
MDYDYRRRVLERNIGMALPSRKLTIANSIDHGNNGNLHIGDIISLYTESSSNQEQRGFLSTLGLVDDRCIVELKDGRPES
PPKKFRDCLFKVCPVNRYAAQKHLWTEQKRFQTGDSMFDDDLMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHV
KSNKYITVQKNSPAKRERNAMKVYLDRAGNEGSWFIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLSSF
NLLDHQSAAEVNCLNEPTEWQVFMFLLFDENQQNSVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMTNRPSAAD
ATSSRALWEVQVVQTNAYRGGTAKWNKAYRFKHLATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVT
NESTDTTQQNIPSVWVLGPTKSEFPEEDANLLFQLDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSK
NEKGWVKVICEKNRVDKETFALLPVNPDEVRDLDFANDACKALRNFIKLIKIGQVISKESINSTTQLLIDCILFVTNSSD
HLADPLKISDFSPSRDRQKLLREQEVLNQVFLLLKAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCYCLLKYSQ
VSYRKNQEFLAEKFGEIQEQIGFDLMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEA
NKKIQELICTSVLSSKHRDIFMDTKIIDGEIEVGWAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLA
IDPPPERRLMNISQQLPAELVLQCMSDNRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVE
AYSDGSRMRIGEGIAHKVLATVETYLMGLRNQSMEERQSVNSSKLTYEIVNLAKALAQFNFYSFNDLLQLTQNLLAIINE
GPATEQVPSHRAMVNAIRNMSKSMMRGGNKENSKDLAKTPSVTAEEAGRTKEGRALNVKTKLIVAEILQFVMDVRRDYRI
TMALSWFKNVFPCDEDGSLMHSASINERMASELYDAIYRSSGHELHLDGRDGQLLLAILLQMTMSDYPPLTSIALKVFFR
HFTQYQELLEDLKQVQLLVSNNDVENYRQIDRDLFILKNLTEKSELWVHGDRHHSIDTKEVDEKERTTEHDLLDHDLKSP
RAFDSGDSMEALMAVLNEHYPSIRNECLQLLNRLLIKDDRNDAAVALQELSDKAPLIAYPLIRQMLVRLTGMCYRKGDPK
PDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHDMMKLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIE
EVGTLVAIFRNNRELASNVPEELIAHIVGLIEHNSRNPIFLELLQALVCVYDKEIESGQEKVANEICAASDEVRQLYVDN
ASFEELEAMMKDEKESKGRSSDSRRKLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQ
LLLHCYIDTDAEMKDAYKTEYVDHILNNLLEDIRSLRVEKLTGAETATLEHYICHTVTEVLIKFFEAPYSALQQAKVDVH
HHKKTFSEVLLELTYLEKGKLRGSKSSRNWYRVAECIKRLTKWAEEHNITLPATLAGPQMSGQTSVRQKWQQAASSAKWI
GIGKRLNRQNTLNPGHRLYGTSNSMTEHTSANVVTCYHMMIGEFKFYLHPLHAAEGSVLVEVLHTPELLFPEGSALRDQC
ARGGVVAKLIQHCKTLMQNKQDNLCARVLQTLCKMCDCTKQQLTHQGQQLRQLLLQRYFGHHNNHHPPLDRQQSKIGEVI
EAVKEKKEETWSQERDLYAIQCKLNDAGASDLVTDIIIMEPSREIFLKAIHLARALLHEGNDKVQHSFYMRMKQKDIHEP
FFKAILTRIQTAQNRLKSDMMSCSDSKPKVSLSATVSRRSSTVLTPLIDAGDTGFNGALFEVPQQVRHPSISEMSQLSND
LTHSIPDLAPYQDEEKSTDALPPEVALVEPILRVLQLLCENHNSLLQNFLRKQSDRTNHNLVSETLSFLDTVCGSTKGSL
GVFGEIGEHNFSLITQTLATLTEFCQGPCHENQNTMAMQENGLNIIISLVLNEIKPLADDHMELALEIKSQASKLLLAIM
ESRHDGENANRVLRNMANMSGGPKQLVHAIKQAYEMTNSNHHMLKSISRDLFRQAEDDLKKKSGPQITVNTVTLPEINVD
ASGIVSIHTEKNISSSLDDKFNDDDIPSVDPREVGHNIYILAHQLAIHDGELEIWLDGSDEKKDDLTREALNYYKERTAQ
IEIVRRDRTLERVVFPINDICSYLTKDTKDYVYNNTERDNQGSKVTEFFDEWETMYHEMIWQRKLQDRKWLSWCAFRLPL
WTRLSFHFAFIVNALVARYYPLPEHSNSSISLGNLYSWFAVFSSFLLAHYLRHDKIYLHKTSLLILASLCFLLLSSIGVT
LTLYIFGILQLVNKIVHVVAFVSNKGLEDRPIAEILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVI
ASVTRNYQSIVWTGLLALILLYFFSILGFLYFRHDFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEK
KVKSCETLWMCILQTGYQGLRNGGGIGDVLRNPAPWEDMFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEK
EQILKNNCFICGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSL
QDSELDTDQSEVKQMKDQLLQMMTLMREIISQNEESRAFMEQFQPR
Estimated Isoelectric Point:
6.07506561279297
Estimated Molecular Weight:
325.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr145
Lys170
Gln141
Leu328
Gly117
Met82
Ser209
Tyr87
His94
Glu205
Arg155
Cys52
Phe106
Pro99
Val175
Asn157
Ala163
Ile162
Trp31
Asp168