Sequence:
download
CE28003sequence.fasta
>DAF-3, isoform f MGDHHNLTGLPGTSIPPQFNYSQPGTSTGGPLYGGKPSHGLEDIPDVEEYERNLLGAGAGFNLLNVGNMANVPDEHTPMM SPVNTTTKILQRSGIKMEIPPYLDPDSQDDDPEDGVNYPDPDLFDTKNTNMTEYDLDVLKLGKPAVDEARKKIEVPDASA PPNKIVEYLMYYRTLKESELIQLNAYRTKRNRLSLNLVKNNIDREFDQKACESLVKKLKDKKNDLQNLIDVVLSKGTKYT GCITIPRTLDGRLQVHGRKGFPHVVYGKLWRFNEMTKNETRHVDHCKHAFEMKSDMVCVNPYHYEIVIGTMIVGQRDHDN RDMPPPHQRYHTPGRQDPVDDMSRFIPPASIRPPPMNMHTRPQPMPQQLPSVGATFAHPLPHQAPHNPGVSHPYSIAPQT HYPLNMNPIPQMPQMPQMPPPLHQGYGMNGPSCSSENNNPFHQNHHYNDISHPNHYSYDCGPNLYGFPTPYPDFHHPFNQ QPHQPPQLSQNHTSQQGSHQPGHQGQVPNDPPISRPVLQPSTVTLDVFRRYCRQTFGNRFFEGESEQSGAIIRSSNKFIE EFDSPICGVTVVRPRMTDGEVLENIMPEDAPYHDICKFILRLTSESVTFSGEGPEVSDLNEKWGTIVYYEKNLQIGEKKC SRGNFHVDGGFICSENRYSLGLEPNPIREPVAFKVRKAIVDGIRFSYKKDGSVWLQNRMKYPVFVTSGYLDEQSGGLKKD KVHKVYGCASIKTFGFNVSKQIIRDALLSKQMATMYLQGKLTPMNYIYEKKTQEELRREATRTTDSLAKYCCVRVSFCKG FGEAYPERPSIHDCPVWIELKINIAYDFMDSICQYITNCFEPLGMEDFAKLGINVSDD
view sequence (858 aa)
>DAF-3, isoform f
MGDHHNLTGLPGTSIPPQFNYSQPGTSTGGPLYGGKPSHGLEDIPDVEEYERNLLGAGAGFNLLNVGNMANVPDEHTPMM
SPVNTTTKILQRSGIKMEIPPYLDPDSQDDDPEDGVNYPDPDLFDTKNTNMTEYDLDVLKLGKPAVDEARKKIEVPDASA
PPNKIVEYLMYYRTLKESELIQLNAYRTKRNRLSLNLVKNNIDREFDQKACESLVKKLKDKKNDLQNLIDVVLSKGTKYT
GCITIPRTLDGRLQVHGRKGFPHVVYGKLWRFNEMTKNETRHVDHCKHAFEMKSDMVCVNPYHYEIVIGTMIVGQRDHDN
RDMPPPHQRYHTPGRQDPVDDMSRFIPPASIRPPPMNMHTRPQPMPQQLPSVGATFAHPLPHQAPHNPGVSHPYSIAPQT
HYPLNMNPIPQMPQMPQMPPPLHQGYGMNGPSCSSENNNPFHQNHHYNDISHPNHYSYDCGPNLYGFPTPYPDFHHPFNQ
QPHQPPQLSQNHTSQQGSHQPGHQGQVPNDPPISRPVLQPSTVTLDVFRRYCRQTFGNRFFEGESEQSGAIIRSSNKFIE
EFDSPICGVTVVRPRMTDGEVLENIMPEDAPYHDICKFILRLTSESVTFSGEGPEVSDLNEKWGTIVYYEKNLQIGEKKC
SRGNFHVDGGFICSENRYSLGLEPNPIREPVAFKVRKAIVDGIRFSYKKDGSVWLQNRMKYPVFVTSGYLDEQSGGLKKD
KVHKVYGCASIKTFGFNVSKQIIRDALLSKQMATMYLQGKLTPMNYIYEKKTQEELRREATRTTDSLAKYCCVRVSFCKG
FGEAYPERPSIHDCPVWIELKINIAYDFMDSICQYITNCFEPLGMEDFAKLGINVSDD
Estimated Isoelectric Point:
6.40746307373047
Estimated Molecular Weight:
97.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr43
Lys50
Gln42
Leu56
Gly60
Met29
Ser52
Tyr39
His35
Glu47
Arg41
Cys18
Phe33
Pro82
Val49
Asn52
Ala27
Ile45
Trp4
Asp54