Sequence:
download
CE27941sequence.fasta
>IFB-2, isoform c MSAVSYSMHRTTTTTSSSSHGGVSAGHAAEEFVASAEREKQEMQQLNSRLEVYISRVRQLEDRNKELVIELDTLRGSLGN DIGQIKFKFNDSLVKVRREISEAHSGTIGVEVKVDRLRDDLNDYRHRYEEARREVEREKTTWGGAISQAQAELDTNKSRY AAILDEEKRLYAEQDQLYLQLAAAKDELDAAIVDRRRLQAEEDDLKIELEFLGRIHSQEITELRTLLAQAPADTREFFKN ELALAIREIKAEYDKIIQTTRVDLETIFQSKISAVESSIVSKNEAAVFRQEEIRKMNESITTLRAKLSELEARNSALERE ANTLQIQLGEDQRAYESELHKRDNALRFMREDCQTLIAELQALLNTKQTLDTEIAIYRKLVESEEGRLVPVEQDHWDSGE VQTRSSFKRHAKGNVSIVECDPQGKYIILENTSGSVAEDVSNFEIRRVIDGVQAFVFRLPSHLVIQQHGHLKIYGRNSGG INSPPDSIVMESHPSWGQGGQVETFLYNSHGIEKASHIQTTVASSR
view sequence (526 aa)
>IFB-2, isoform c
MSAVSYSMHRTTTTTSSSSHGGVSAGHAAEEFVASAEREKQEMQQLNSRLEVYISRVRQLEDRNKELVIELDTLRGSLGN
DIGQIKFKFNDSLVKVRREISEAHSGTIGVEVKVDRLRDDLNDYRHRYEEARREVEREKTTWGGAISQAQAELDTNKSRY
AAILDEEKRLYAEQDQLYLQLAAAKDELDAAIVDRRRLQAEEDDLKIELEFLGRIHSQEITELRTLLAQAPADTREFFKN
ELALAIREIKAEYDKIIQTTRVDLETIFQSKISAVESSIVSKNEAAVFRQEEIRKMNESITTLRAKLSELEARNSALERE
ANTLQIQLGEDQRAYESELHKRDNALRFMREDCQTLIAELQALLNTKQTLDTEIAIYRKLVESEEGRLVPVEQDHWDSGE
VQTRSSFKRHAKGNVSIVECDPQGKYIILENTSGSVAEDVSNFEIRRVIDGVQAFVFRLPSHLVIQQHGHLKIYGRNSGG
INSPPDSIVMESHPSWGQGGQVETFLYNSHGIEKASHIQTTVASSR
Estimated Isoelectric Point:
5.40749359130859
Estimated Molecular Weight:
59.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr28
Lys26
Gln31
Leu47
Gly26
Met6
Ser45
Tyr13
His15
Glu60
Arg44
Cys2
Phe14
Pro7
Val32
Asn19
Ala43
Ile36
Trp3
Asp29