Sequence:
download
CE27889sequence.fasta
>GPA-10 MGVCQSFVLTDEMKDQIKVNKEIEKQLEKKKNMQLEQTVLLLGPGESGKSTVMKQMRAMTGNYTKTELHERKVLIIQNLC QFSEMLLEYVREYILEMTEDDDKRYTVMCEELKMAVIHDGIMRPELADTLKEFWGNSAIQDAYSKRDTFHLTDSAKYFFD NIDRIKLPGFEPTNQDIVHIRVPTTGVAQVEVIMNNIKLMICDCGGQRSERRKWYHFFDEADAVLFVAAISEFDQKLAED EETNRMHESIRLFWTVFNGKFFKKAAVILFLNKIDLFEEKVKHVKIKDYFPKFEGANTVSEGTKFFRRQFREGIHPDFKK RMYTHETCAISDQVQIIINTVIDTVIQDNLKDTGMI
view sequence (356 aa)
>GPA-10
MGVCQSFVLTDEMKDQIKVNKEIEKQLEKKKNMQLEQTVLLLGPGESGKSTVMKQMRAMTGNYTKTELHERKVLIIQNLC
QFSEMLLEYVREYILEMTEDDDKRYTVMCEELKMAVIHDGIMRPELADTLKEFWGNSAIQDAYSKRDTFHLTDSAKYFFD
NIDRIKLPGFEPTNQDIVHIRVPTTGVAQVEVIMNNIKLMICDCGGQRSERRKWYHFFDEADAVLFVAAISEFDQKLAED
EETNRMHESIRLFWTVFNGKFFKKAAVILFLNKIDLFEEKVKHVKIKDYFPKFEGANTVSEGTKFFRRQFREGIHPDFKK
RMYTHETCAISDQVQIIINTVIDTVIQDNLKDTGMI
Estimated Isoelectric Point:
5.81807708740234
Estimated Molecular Weight:
41.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr23
Lys33
Gln17
Leu25
Gly16
Met16
Ser12
Tyr9
His9
Glu32
Arg17
Cys6
Phe23
Pro7
Val24
Asn15
Ala16
Ile28
Trp3
Asp25