Sequence:
download
CE27822sequence.fasta
>UBC-1 MTTPSRRRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPN VYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQQIVEQSWLNFGENEGDAV LKDDVEIEEIAAPGANDADDDRMDEGASGSNA
view sequence (192 aa)
>UBC-1
MTTPSRRRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPN
VYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQQIVEQSWLNFGENEGDAV
LKDDVEIEEIAAPGANDADDDRMDEGASGSNA
Estimated Isoelectric Point:
4.30060577392578
Estimated Molecular Weight:
21.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys8
Gln9
Leu14
Gly10
Met4
Ser13
Tyr5
His1
Glu19
Arg9
Cys1
Phe8
Pro15
Val8
Asn12
Ala16
Ile11
Trp3
Asp16