Sequence:
download
CE27781sequence.fasta
>MES-4 MLPSSGDSSKENCAPQDGIVEKEGPNKPFKKKNVKQRNATPQGAGSETSSNAEDKQEEAPILTNAPKDIISMQIQETKAF LSEYEEFVDTDYPKTTFTHVPRKFLSVSPFTPIEADAEGEFLPDADSKCVICHEEKDKTGKSDLITCHGYINGEMDDGKR LLGNIPMFPCRSKFHASCMINYNSGGFHFQYAARLECQARLLCPLHCCNSCNLDHHKQSAYVGDIAECALCLRAFHLTSC YPSGGRDLNVSITIGGKVEKFEMIICPAHYLPGADVQFYNKHKKRKNAVTVVPKADVTMKSHIKACCVIGCEKSSNSKTI MCKTCCRSFHSGCREVETLNGKPIPDDQCESCVCGDPIPQNTLILAKWTDNSFWLALTLDWYKYPTGNRGNINFERLGYT VVQWLIPQENDKEKQPLMSIVPVSDIARLTKNYFSLAKNSTLRNLWEEKYEEQADTALKRCPYVCKTVFGRLRTSVYYKC EPKLEEYHNNEVCNCEGADRCTKLSCQYLADDYECPPSCSKKGVCHNRQVSMGIVSEKIKLAATLCKGYGVFAKGQIEKD EYICEYVGEIIDKAEKKRRLDSVSISRDFQANHYMMELHKGLTVDAARYGNISRYINHSCDPNAASFVTKVFVKKTKEGS LYDTRSYIRAIRTIDDGDEITFSYNMNNEENLPDCECGAENCMGTMGKAKREKPEVADSSEKAAKKNKSSKKKSVKNQNR KSQEAGKNGTASKKSEISPSKPSTSSASSTSFVQQASWPISQNKKNLKKNSNQPVADTGSTLSTSTELNFHEKPQELLSP VSSRSRAASSSTPRAQKSKSRRDDVESEAPPVKRATPSLQTIQETGKAIEFPATKSAITKARALSTQSVPSPHTVEVKVR AISTRGRVQKETKRFEPI
view sequence (898 aa)
>MES-4
MLPSSGDSSKENCAPQDGIVEKEGPNKPFKKKNVKQRNATPQGAGSETSSNAEDKQEEAPILTNAPKDIISMQIQETKAF
LSEYEEFVDTDYPKTTFTHVPRKFLSVSPFTPIEADAEGEFLPDADSKCVICHEEKDKTGKSDLITCHGYINGEMDDGKR
LLGNIPMFPCRSKFHASCMINYNSGGFHFQYAARLECQARLLCPLHCCNSCNLDHHKQSAYVGDIAECALCLRAFHLTSC
YPSGGRDLNVSITIGGKVEKFEMIICPAHYLPGADVQFYNKHKKRKNAVTVVPKADVTMKSHIKACCVIGCEKSSNSKTI
MCKTCCRSFHSGCREVETLNGKPIPDDQCESCVCGDPIPQNTLILAKWTDNSFWLALTLDWYKYPTGNRGNINFERLGYT
VVQWLIPQENDKEKQPLMSIVPVSDIARLTKNYFSLAKNSTLRNLWEEKYEEQADTALKRCPYVCKTVFGRLRTSVYYKC
EPKLEEYHNNEVCNCEGADRCTKLSCQYLADDYECPPSCSKKGVCHNRQVSMGIVSEKIKLAATLCKGYGVFAKGQIEKD
EYICEYVGEIIDKAEKKRRLDSVSISRDFQANHYMMELHKGLTVDAARYGNISRYINHSCDPNAASFVTKVFVKKTKEGS
LYDTRSYIRAIRTIDDGDEITFSYNMNNEENLPDCECGAENCMGTMGKAKREKPEVADSSEKAAKKNKSSKKKSVKNQNR
KSQEAGKNGTASKKSEISPSKPSTSSASSTSFVQQASWPISQNKKNLKKNSNQPVADTGSTLSTSTELNFHEKPQELLSP
VSSRSRAASSSTPRAQKSKSRRDDVESEAPPVKRATPSLQTIQETGKAIEFPATKSAITKARALSTQSVPSPHTVEVKVR
AISTRGRVQKETKRFEPI
Estimated Isoelectric Point:
8.69162750244141
Estimated Molecular Weight:
100.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr54
Lys89
Gln32
Leu50
Gly46
Met15
Ser86
Tyr29
His20
Glu66
Arg41
Cys41
Phe28
Pro48
Val47
Asn48
Ala62
Ile46
Trp6
Asp44