Sequence:
download
CE27651sequence.fasta
>PLD-1 MESEDEESRRPQTTSSGHLEPKDTTENNSVDSSVMHDRGIPGLLPATKASDKQKKAVIRFREHEGRADSPPSNLNVRRDS KTVHIDEVSSPQSLDYGDSDDSSDDDEIQYCDCVAAALQQSLPGTPGRKGIIPYMSIYDTQQQARRRGYWIPGVPVNAKI VKVERNTDRGIHFINTLLYTIELEHGQFRWSVIRNYKDFTLLNNRLMAHRAREQFMAPIKRTQERFDNYLEHMGIDIISD HKPECPYSNQSSKRKRHPKLQVLKRDSDGIEESKNTSAPLASVESPGEVEDAFKKEVHMQQAVQSGILDETVNEANTSEG TPKRQRRQQRKKDRHTLPRFPMMPDSMVTNLEHRKELLENWLQMVLHIPINRNHHETAEFLEVSRYSFVNELGGKHTEGF VKKRPGGSRVFLGWKQCCVRYLLPWSKRWLMVRDSFVAYMDHRTEQIRMVLLMDRDFKVAAGGKETEGIPTGLIITNSQH ELHLKCRRLQDTATWKYIIEQAMGGIGNTWLQPHRFSSSFPVRENCHAKWFVDAKTYMEYAADMMELAREEIYITDWWLS PEIYMKRPALEGNYWRLDEILKRKAEQGVKIFILLYKEMEMALGLNSIYSKRTLQGLHENIKVMRHPDHYPSTGTFFWAH HEKLLIIDQLISFVGGVDLCFGRWDDHRHLLTDLGSVQYSGAHQVATNMASGLRSLMTAPLTLSPLGLEEHEKVTPRNEN GGKNGSVKRVAVEEINEVDEPKEVTGRTQETELTDNEDISEDSDVKKIMEETIFTDKETGGVVVRTLNRFPVDEAIRHSS PADPQKNWKETKTTVVESTSTSGGVTSKTTTTTTTTRVVKDNTLEKEKNKKELRRAVTSLERQRKHVPREILDKAGPAPS MIEKAAKSGMDFASAAEKYKEYVASGAVQKEKHRAQTPPNRRKAKKDSRITRAVGAVGNWKSNRAKRKWKQMLESDEATM GYELDWLRLREMDEKGDGDDEIDGGAKLWYGKDYVNYIAKDFVEVDMPFHDFIDRGSTPRMPWHDIHSVTFGAPARDLAR HFIQRWNATKTEKLKDDKNYPYLLPKSYENVRVPRVFKTANASEMVNVQVLRSLSNWSGLINQTEDSIQMAYLSLIANSK HYIYIENQFFVSMIESNDVTNEVCKVIYNRIVRAYKEKDNYRVYIMIPLLPGFEGDVGAPGGSSLQAVLHWTYQSLSQGP NSLIQRLKAVMPDPFKYIHVGSLRTYDQLGQKLVSELVYIHCKLLIVDDEHVIIGSANINDRSQCGNRDSEVCCVYTDVV KERSVMDGKPFEAGRFAKSLRMQCMREHLGLLPDSRRKAKFPYAVSCDDPVADSFFVDVWQSTAKSNGQIYEEVFRSYPT DFVETFEEFQKWTSQIPMSEYSPQQAEERVRDLKGVLVDFPLNFLCKAVLTPGITSKEGLVPSAVFT
view sequence (1427 aa)
>PLD-1
MESEDEESRRPQTTSSGHLEPKDTTENNSVDSSVMHDRGIPGLLPATKASDKQKKAVIRFREHEGRADSPPSNLNVRRDS
KTVHIDEVSSPQSLDYGDSDDSSDDDEIQYCDCVAAALQQSLPGTPGRKGIIPYMSIYDTQQQARRRGYWIPGVPVNAKI
VKVERNTDRGIHFINTLLYTIELEHGQFRWSVIRNYKDFTLLNNRLMAHRAREQFMAPIKRTQERFDNYLEHMGIDIISD
HKPECPYSNQSSKRKRHPKLQVLKRDSDGIEESKNTSAPLASVESPGEVEDAFKKEVHMQQAVQSGILDETVNEANTSEG
TPKRQRRQQRKKDRHTLPRFPMMPDSMVTNLEHRKELLENWLQMVLHIPINRNHHETAEFLEVSRYSFVNELGGKHTEGF
VKKRPGGSRVFLGWKQCCVRYLLPWSKRWLMVRDSFVAYMDHRTEQIRMVLLMDRDFKVAAGGKETEGIPTGLIITNSQH
ELHLKCRRLQDTATWKYIIEQAMGGIGNTWLQPHRFSSSFPVRENCHAKWFVDAKTYMEYAADMMELAREEIYITDWWLS
PEIYMKRPALEGNYWRLDEILKRKAEQGVKIFILLYKEMEMALGLNSIYSKRTLQGLHENIKVMRHPDHYPSTGTFFWAH
HEKLLIIDQLISFVGGVDLCFGRWDDHRHLLTDLGSVQYSGAHQVATNMASGLRSLMTAPLTLSPLGLEEHEKVTPRNEN
GGKNGSVKRVAVEEINEVDEPKEVTGRTQETELTDNEDISEDSDVKKIMEETIFTDKETGGVVVRTLNRFPVDEAIRHSS
PADPQKNWKETKTTVVESTSTSGGVTSKTTTTTTTTRVVKDNTLEKEKNKKELRRAVTSLERQRKHVPREILDKAGPAPS
MIEKAAKSGMDFASAAEKYKEYVASGAVQKEKHRAQTPPNRRKAKKDSRITRAVGAVGNWKSNRAKRKWKQMLESDEATM
GYELDWLRLREMDEKGDGDDEIDGGAKLWYGKDYVNYIAKDFVEVDMPFHDFIDRGSTPRMPWHDIHSVTFGAPARDLAR
HFIQRWNATKTEKLKDDKNYPYLLPKSYENVRVPRVFKTANASEMVNVQVLRSLSNWSGLINQTEDSIQMAYLSLIANSK
HYIYIENQFFVSMIESNDVTNEVCKVIYNRIVRAYKEKDNYRVYIMIPLLPGFEGDVGAPGGSSLQAVLHWTYQSLSQGP
NSLIQRLKAVMPDPFKYIHVGSLRTYDQLGQKLVSELVYIHCKLLIVDDEHVIIGSANINDRSQCGNRDSEVCCVYTDVV
KERSVMDGKPFEAGRFAKSLRMQCMREHLGLLPDSRRKAKFPYAVSCDDPVADSFFVDVWQSTAKSNGQIYEEVFRSYPT
DFVETFEEFQKWTSQIPMSEYSPQQAEERVRDLKGVLVDFPLNFLCKAVLTPGITSKEGLVPSAVFT
Estimated Isoelectric Point:
7.15749359130859
Estimated Molecular Weight:
163.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr82
Lys101
Gln57
Leu104
Gly81
Met42
Ser103
Tyr47
His44
Glu111
Arg99
Cys16
Phe47
Pro67
Val100
Asn59
Ala79
Ile72
Trp25
Asp91