Sequence:
download
CE27448sequence.fasta
>RIC-3 MPKTERRRDRDRDRDRERRNRRKRDDSYDDYDEEGGISGWKLGLVFGVIVVCFAMLYPTLFHPMLMGFLGRSPPSSPSIN QQRPPIHPAMGGGSGQRHPGGGADVHPAMRMAQAQAESQSGGSKGMFTWMLPVYTIGVVLFLLYTLFKSKGKKSKRKKRN YFDSEDDDDESESETKYGGKFGKKKLEGLQKRLRETESAMSKILEQLESVQAGANPVDLDAADKRSEQLEEDPSVKEAVG LTETNEQYIKDLEVALKEFQSLSKEYDKAKMKKLKRKDSSSDEDEEDEEENSSELSEIEEEEEEVKPVKKSKSSSQSVGK RKNRPKSTSEEEDEGEEESRKVAEDAEEEGIDIDSEIREHAEKEKKDKNVRRRRPKKT
view sequence (378 aa)
>RIC-3
MPKTERRRDRDRDRDRERRNRRKRDDSYDDYDEEGGISGWKLGLVFGVIVVCFAMLYPTLFHPMLMGFLGRSPPSSPSIN
QQRPPIHPAMGGGSGQRHPGGGADVHPAMRMAQAQAESQSGGSKGMFTWMLPVYTIGVVLFLLYTLFKSKGKKSKRKKRN
YFDSEDDDDESESETKYGGKFGKKKLEGLQKRLRETESAMSKILEQLESVQAGANPVDLDAADKRSEQLEEDPSVKEAVG
LTETNEQYIKDLEVALKEFQSLSKEYDKAKMKKLKRKDSSSDEDEEDEEENSSELSEIEEEEEEVKPVKKSKSSSQSVGK
RKNRPKSTSEEEDEGEEESRKVAEDAEEEGIDIDSEIREHAEKEKKDKNVRRRRPKKT
Estimated Isoelectric Point:
5.50127410888672
Estimated Molecular Weight:
43.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys43
Gln13
Leu24
Gly28
Met11
Ser37
Tyr9
His5
Glu52
Arg30
Cys1
Phe10
Pro17
Val18
Asn8
Ala18
Ile11
Trp2
Asp30