Sequence:
download
CE27352sequence.fasta
>TAX-4 MSTAEPAPDPTNPSTSGLAPTTNGIGSPPPTASAATKFSILTKFLRRKNQVHTTTAQQNEFMQKYMPNGNSNAVQPAATG GQPASSDGGSAIEVPPPKESYAVRIRKYLANYTQDPSTDNFYYWTCVVTVAYIYNLLFVIARQVFNDLIGPSSQSLCRFY NGTLNSTTQVECTYNMLTNMKEMPTYSQYPDLGWSKYWHFRMLWVFFDLLMDCVYLIDTFLNYRMGYMDQGLVVREAEKV TKAYWQSKQYRIDGISLIPLDYILGWPIPYINWRGLPILRLNRLIRYKRVRNCLERTETRSSMPNAFRVVVVVWYIVIII HWNACLYFWISEWIGLGTDAWVYGHLNKQSLPDDITDTLLRRYVYSFYWSTLILTTIGEVPSPVRNIEYAFVTLDLMCGV LIFATIVGNVGSMISNMSAARTEFQNKMDGIKQYMELRKVSKQLEIRVIKWFDYLWTNKQSLSDQQVLKVLPDKLQAEIA MQVHFETLRKVRIFQDCEAGLLAELVLKLQLQVFSPGDFICKKGDIGREMYIVKRGRLQVVDDDGKKVFVTLQEGSVFGE LSILNIAGSKNGNRRTANVRSVGYTDLFVLSKTDLWNALREYPDARKLLLAKGREILKKDNLLDENAPEEQKTVEEIAEH LNNAVKVLQTRMARLIVEHSSTEGKLMKRIEMLEKHLSRYKALARRQKTMHGVSIDGGDISTDGVDERVRPPRLRQTKTI DLPTGTESESLLK
view sequence (733 aa)
>TAX-4
MSTAEPAPDPTNPSTSGLAPTTNGIGSPPPTASAATKFSILTKFLRRKNQVHTTTAQQNEFMQKYMPNGNSNAVQPAATG
GQPASSDGGSAIEVPPPKESYAVRIRKYLANYTQDPSTDNFYYWTCVVTVAYIYNLLFVIARQVFNDLIGPSSQSLCRFY
NGTLNSTTQVECTYNMLTNMKEMPTYSQYPDLGWSKYWHFRMLWVFFDLLMDCVYLIDTFLNYRMGYMDQGLVVREAEKV
TKAYWQSKQYRIDGISLIPLDYILGWPIPYINWRGLPILRLNRLIRYKRVRNCLERTETRSSMPNAFRVVVVVWYIVIII
HWNACLYFWISEWIGLGTDAWVYGHLNKQSLPDDITDTLLRRYVYSFYWSTLILTTIGEVPSPVRNIEYAFVTLDLMCGV
LIFATIVGNVGSMISNMSAARTEFQNKMDGIKQYMELRKVSKQLEIRVIKWFDYLWTNKQSLSDQQVLKVLPDKLQAEIA
MQVHFETLRKVRIFQDCEAGLLAELVLKLQLQVFSPGDFICKKGDIGREMYIVKRGRLQVVDDDGKKVFVTLQEGSVFGE
LSILNIAGSKNGNRRTANVRSVGYTDLFVLSKTDLWNALREYPDARKLLLAKGREILKKDNLLDENAPEEQKTVEEIAEH
LNNAVKVLQTRMARLIVEHSSTEGKLMKRIEMLEKHLSRYKALARRQKTMHGVSIDGGDISTDGVDERVRPPRLRQTKTI
DLPTGTESESLLK
Estimated Isoelectric Point:
9.07027435302734
Estimated Molecular Weight:
83.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys43
Gln32
Leu75
Gly42
Met22
Ser46
Tyr34
His9
Glu38
Arg46
Cys9
Phe25
Pro33
Val54
Asn36
Ala40
Ile46
Trp16
Asp37