Sequence:
download
CE27175sequence.fasta
>DAZ-1 MSPPLRYQKDQQNQQHQQNQSQQAAHQMVSFMPQTPTSLPSTPIQLYPTGAAALIPAPPTYELIPNRIFVGGFPTSTTET ELREHFEKFFAVKDVKMVKSLDGQSKGYGFITFETEDQAEEIRKLTPKQLEFRSRKLNLGPAIRKINSNSFQPSYAIATP SQLVAASPGPFSYAIPASPSPYSGYSYPASPQMFVYPPLRSQDQSRQQSEQQTTPQNSPTNLQHQQSPQVFFGGDQDPIR SYASAVAGVEKSEVSPEKHESVSPQPLLPNQNVLNTQYSQGQQQWNSNVQQQQQQQMDSNNGGPYYNENYSQGYTRPHPY QQFAQSGVYMNSQGMYHSSYSYMTPPLAPGQYPQMMSAPYWQQQQQHHQSHAYAGYNPAYNNWVGPSGDMNQFKQNPSNY FYQNYPGNFSQQHTMGNNENTFSLPLQAPRQGKKSRKPSECQDKKTKSPIKGARTERPSSSASTPDAKYQKNHRYPVHLS PLSASLQSLAISSPTKNN
view sequence (498 aa)
>DAZ-1
MSPPLRYQKDQQNQQHQQNQSQQAAHQMVSFMPQTPTSLPSTPIQLYPTGAAALIPAPPTYELIPNRIFVGGFPTSTTET
ELREHFEKFFAVKDVKMVKSLDGQSKGYGFITFETEDQAEEIRKLTPKQLEFRSRKLNLGPAIRKINSNSFQPSYAIATP
SQLVAASPGPFSYAIPASPSPYSGYSYPASPQMFVYPPLRSQDQSRQQSEQQTTPQNSPTNLQHQQSPQVFFGGDQDPIR
SYASAVAGVEKSEVSPEKHESVSPQPLLPNQNVLNTQYSQGQQQWNSNVQQQQQQQMDSNNGGPYYNENYSQGYTRPHPY
QQFAQSGVYMNSQGMYHSSYSYMTPPLAPGQYPQMMSAPYWQQQQQHHQSHAYAGYNPAYNNWVGPSGDMNQFKQNPSNY
FYQNYPGNFSQQHTMGNNENTFSLPLQAPRQGKKSRKPSECQDKKTKSPIKGARTERPSSSASTPDAKYQKNHRYPVHLS
PLSASLQSLAISSPTKNN
Estimated Isoelectric Point:
9.19919586181641
Estimated Molecular Weight:
56.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys23
Gln68
Leu24
Gly26
Met13
Ser59
Tyr31
His13
Glu19
Arg16
Cys1
Phe19
Pro54
Val17
Asn32
Ala31
Ile13
Trp3
Asp11