Sequence:
download
CE27109sequence.fasta
>CHO-1 MADLLGIVAIVFFYVLILVVGIWAGRKSKSSKELESEAGAATEEVMLAGRNIGTLVGIFTMTATWVGGAYINGTAEALYN GGLLGCQAPVGYAISLVMGGLLFAKKMREEGYITMLDPFQHKYGQRIGGLMYVPALLGETFWTAAILSALGATLSVILGI DMNASVTLSACIAVFYTFTGGYYAVAYTDVVQLFCIFVGLWVCVPAAMVHDGAKDISRNAGDWIGEIGGFKETSLWIDCM LLLVFGGIPWQVYFQRVLSSKTAHGAQTLSFVAGVGCILMAIPPALIGAIARNTDWRMTDYSPWNNGTKVESIPPDKRNM VVPLVFQYLTPRWVAFIGLGAVSAAVMSSADSSVLSAASMFAHNIWKLTIRPHASEKEVIIVMRIAIICVGIMATIMALT IQSIYGLWYLCADLVYVILFPQLLCVVYMPRSNTYGSLAGYAVGLVLRLIGGEPLVSLPAFFHYPMYTDGVQYFPFRTTA MLSSMATIYIVSIQSEKLFKSGRLSPEWDVMGCVVNIPIDHVPLPSDVSFAVSSETLNMKAPNGTPAPVHPNQQPSDENT LLHPYSDQSYYSTNSN
view sequence (576 aa)
>CHO-1
MADLLGIVAIVFFYVLILVVGIWAGRKSKSSKELESEAGAATEEVMLAGRNIGTLVGIFTMTATWVGGAYINGTAEALYN
GGLLGCQAPVGYAISLVMGGLLFAKKMREEGYITMLDPFQHKYGQRIGGLMYVPALLGETFWTAAILSALGATLSVILGI
DMNASVTLSACIAVFYTFTGGYYAVAYTDVVQLFCIFVGLWVCVPAAMVHDGAKDISRNAGDWIGEIGGFKETSLWIDCM
LLLVFGGIPWQVYFQRVLSSKTAHGAQTLSFVAGVGCILMAIPPALIGAIARNTDWRMTDYSPWNNGTKVESIPPDKRNM
VVPLVFQYLTPRWVAFIGLGAVSAAVMSSADSSVLSAASMFAHNIWKLTIRPHASEKEVIIVMRIAIICVGIMATIMALT
IQSIYGLWYLCADLVYVILFPQLLCVVYMPRSNTYGSLAGYAVGLVLRLIGGEPLVSLPAFFHYPMYTDGVQYFPFRTTA
MLSSMATIYIVSIQSEKLFKSGRLSPEWDVMGCVVNIPIDHVPLPSDVSFAVSSETLNMKAPNGTPAPVHPNQQPSDENT
LLHPYSDQSYYSTNSN
Estimated Isoelectric Point:
5.86614227294922
Estimated Molecular Weight:
62.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr33
Lys16
Gln15
Leu57
Gly51
Met24
Ser43
Tyr27
His9
Glu19
Arg16
Cys10
Phe24
Pro29
Val53
Asn18
Ala56
Ile44
Trp13
Asp19