Sequence:
download
CE27050sequence.fasta
>CYP-23A1 MPSLRNAILLTIATTFLYFRIMRTLNFDNYMATYIYFLTCITLYAIYELNYKRRRLPNGPVPWLVAGNMPSFINVNNVDV LFQSWKQQYGGIFTVWIGPIPLVMVSDLPTIKKYFIQHADSFSNRWRNFVTDSIMEGSNGIVQIDGNKWREQRRFALHTL RDFGVGKPLMEQMITLEVTSLMNHMEKSCGLDGKELHLCPSIAVCVGNIINNMLFGLRFNQDNSYMHRLHQLLDDQSHTV MQPIMGAYIAFPVTSKIPIINGEWNRLMGIKNELLEFLETQIEGHRMNWKDEMIEQEPEDLTYAYMIEVEKRKRNGEDVG FFDDQQLKMLLLDLFFAGMETTVTTLKWAFLLMAKNQKVQKNVQAELDSIGQPMIEIQHRTRLPYVQATINEIQRIANIL PINLLRTVAEDIEIDGYNFKKGDLIIPQISILMNDPEIFENPEEFNPSRFLDEDNNVKKIDEFLPFSIGRRQCLGESLAR AELYLVFANLIQNFNFEVADDVTTERVLGLTVSPVEYSCKITRRGLDHNQNSVK
view sequence (534 aa)
>CYP-23A1
MPSLRNAILLTIATTFLYFRIMRTLNFDNYMATYIYFLTCITLYAIYELNYKRRRLPNGPVPWLVAGNMPSFINVNNVDV
LFQSWKQQYGGIFTVWIGPIPLVMVSDLPTIKKYFIQHADSFSNRWRNFVTDSIMEGSNGIVQIDGNKWREQRRFALHTL
RDFGVGKPLMEQMITLEVTSLMNHMEKSCGLDGKELHLCPSIAVCVGNIINNMLFGLRFNQDNSYMHRLHQLLDDQSHTV
MQPIMGAYIAFPVTSKIPIINGEWNRLMGIKNELLEFLETQIEGHRMNWKDEMIEQEPEDLTYAYMIEVEKRKRNGEDVG
FFDDQQLKMLLLDLFFAGMETTVTTLKWAFLLMAKNQKVQKNVQAELDSIGQPMIEIQHRTRLPYVQATINEIQRIANIL
PINLLRTVAEDIEIDGYNFKKGDLIIPQISILMNDPEIFENPEEFNPSRFLDEDNNVKKIDEFLPFSIGRRQCLGESLAR
AELYLVFANLIQNFNFEVADDVTTERVLGLTVSPVEYSCKITRRGLDHNQNSVK
Estimated Isoelectric Point:
5.53139495849609
Estimated Molecular Weight:
61.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr28
Lys24
Gln26
Leu56
Gly28
Met23
Ser22
Tyr17
His10
Glu36
Arg29
Cys6
Phe30
Pro23
Val31
Asn40
Ala22
Ile47
Trp8
Asp28