Sequence:
download
CE26704sequence.fasta
>BAF-1 MSTSVKHREFVGEPMGDKEVTCIAGIGPTYGTKLTDAGFDKAYVLFGQYLLLKKDEDLFIEWLKETAGVTANHAKTAFNC LNEWADQFM
view sequence (89 aa)
>BAF-1
MSTSVKHREFVGEPMGDKEVTCIAGIGPTYGTKLTDAGFDKAYVLFGQYLLLKKDEDLFIEWLKETAGVTANHAKTAFNC
LNEWADQFM
Estimated Isoelectric Point:
4.99530792236328
Estimated Molecular Weight:
9.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys8
Gln2
Leu8
Gly8
Met3
Ser2
Tyr3
His2
Glu7
Arg1
Cys2
Phe6
Pro2
Val5
Asn3
Ala8
Ile3
Trp2
Asp6