Sequence:
download
CE26703sequence.fasta
>LIN-22 MTSFLCSDTEIESDGGISRCKKIKNKPLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAVEYLQQLRS AQPCSLSPSTSSISTPPTPKEEIRNIKVPLNPIASFLNPMMQQYVAYQQLAQLSMYTQLFNNPAGVPLRADAGVTAQSPE LAEKLKIEDRSRV
view sequence (173 aa)
>LIN-22
MTSFLCSDTEIESDGGISRCKKIKNKPLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAVEYLQQLRS
AQPCSLSPSTSSISTPPTPKEEIRNIKVPLNPIASFLNPMMQQYVAYQQLAQLSMYTQLFNNPAGVPLRADAGVTAQSPE
LAEKLKIEDRSRV
Estimated Isoelectric Point:
9.27748870849609
Estimated Molecular Weight:
19.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys15
Gln14
Leu17
Gly4
Met6
Ser19
Tyr4
His2
Glu12
Arg9
Cys3
Phe3
Pro12
Val6
Asn8
Ala12
Ile13
Trp1
Asp6