Sequence:
download
CE26468sequence.fasta
>RME-6, isoform b MLDIYVTAQDKLNCVVRCCDVINNLVALSSKNAVASADDLTPVLVFVIIKANPRALLSNVQFVETFAGDRIESGRDAYYW VNFKSAVEYIKTIL
view sequence (94 aa)
>RME-6, isoform b
MLDIYVTAQDKLNCVVRCCDVINNLVALSSKNAVASADDLTPVLVFVIIKANPRALLSNVQFVETFAGDRIESGRDAYYW
VNFKSAVEYIKTIL
Estimated Isoelectric Point:
5.16139984130859
Estimated Molecular Weight:
10.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr4
Lys5
Gln2
Leu9
Gly2
Met1
Ser6
Tyr4
Glu3
Arg4
Cys3
Phe4
Pro2
Val13
Asn7
Ala10
Ile7
Trp1
Asp7