Sequence:
download
CE26143sequence.fasta
>KLP-20 MEGAEKVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKSLSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVL KGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKDHNGNL EIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCRNGLVTQGKLQLVDLAGS ERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLS TLRYANRAKNIQNVAKINEDPKDAQLRKFQLEIEALRKILDEENPGDDENQEEAWEAKMQEREVEMEKKRKILEERVNSA VNDEETHRLVKEMMENEAELKKARSEHEKLRSKLEKIEKKLIVGGENLLEKVEEQAKLLEVNNKELEQSKFQEAHLRTQL EERTAVKVEIEERYSSLQEEAFVKSKKIKKVSNELKDARAELKDLEEDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPV EHVELIEKYVSWSEEHGDWQLKAIAYTGNNMRASAPPAKKEFSNNNQTVPMYYSYRADLGASTAEHRPRTSSKKHRASIR LQQLLT
view sequence (646 aa)
>KLP-20
MEGAEKVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKSLSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVL
KGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKDHNGNL
EIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCRNGLVTQGKLQLVDLAGS
ERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLS
TLRYANRAKNIQNVAKINEDPKDAQLRKFQLEIEALRKILDEENPGDDENQEEAWEAKMQEREVEMEKKRKILEERVNSA
VNDEETHRLVKEMMENEAELKKARSEHEKLRSKLEKIEKKLIVGGENLLEKVEEQAKLLEVNNKELEQSKFQEAHLRTQL
EERTAVKVEIEERYSSLQEEAFVKSKKIKKVSNELKDARAELKDLEEDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPV
EHVELIEKYVSWSEEHGDWQLKAIAYTGNNMRASAPPAKKEFSNNNQTVPMYYSYRADLGASTAEHRPRTSSKKHRASIR
LQQLLT
Estimated Isoelectric Point:
6.11992645263672
Estimated Molecular Weight:
73.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr34
Lys57
Gln28
Leu59
Gly29
Met16
Ser42
Tyr18
His15
Glu76
Arg39
Cys4
Phe14
Pro18
Val43
Asn41
Ala48
Ile34
Trp3
Asp28