Sequence:
download
CE25876sequence.fasta
>CHE-2 MKLKLSASRKTRHTEMVCGVGWIGTEAILSAADDHVFLLTNTATNESQQILNMPETFFPTSLHIFPRSQTKGGQNDVFAV STSDGKINILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMLRSVLAQFATAVYCVAWDSTSSNV LYCNADHCYIKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDGFGQILFNSSVHDYPITSISWNTDGT LFAVGSHNILRLCDKSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTYEEFEIVQTQKTVIEVRD VSSEVSRETLETKERISKIAILYKYLIVVTSSHIYIYSSKNWNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTYEG RKLINLNPPGQVMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGNLKHEHDIVELTVNQCGPLNDRNVAFR DQIGAVHIAMVKTFGVSQRMVKIGSLVEQLVFNDVTNMLCGISEGKIAVWPLPNVAFHDRNLLQKSLIQKNIGSVGKFPQ LANFAGNTIVIRKSDGCLLPTGILPFYGTLITMASQSKWDQAIRLCRSIGNDTMWATFAGLAVLHKNMIVMEIAYAALED DEKVSLINEIKDKTDKETRQAMQVVLTGKLADADVLLERSGLSFRSLMLNIQMFKWKRALELGLKNKQWLEIVMGYREKY LKNCGQKETDPLFLKHMSEVEIDWVHIRELIAAEKAKGNN
view sequence (760 aa)
>CHE-2
MKLKLSASRKTRHTEMVCGVGWIGTEAILSAADDHVFLLTNTATNESQQILNMPETFFPTSLHIFPRSQTKGGQNDVFAV
STSDGKINILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMLRSVLAQFATAVYCVAWDSTSSNV
LYCNADHCYIKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDGFGQILFNSSVHDYPITSISWNTDGT
LFAVGSHNILRLCDKSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTYEEFEIVQTQKTVIEVRD
VSSEVSRETLETKERISKIAILYKYLIVVTSSHIYIYSSKNWNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTYEG
RKLINLNPPGQVMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGNLKHEHDIVELTVNQCGPLNDRNVAFR
DQIGAVHIAMVKTFGVSQRMVKIGSLVEQLVFNDVTNMLCGISEGKIAVWPLPNVAFHDRNLLQKSLIQKNIGSVGKFPQ
LANFAGNTIVIRKSDGCLLPTGILPFYGTLITMASQSKWDQAIRLCRSIGNDTMWATFAGLAVLHKNMIVMEIAYAALED
DEKVSLINEIKDKTDKETRQAMQVVLTGKLADADVLLERSGLSFRSLMLNIQMFKWKRALELGLKNKQWLEIVMGYREKY
LKNCGQKETDPLFLKHMSEVEIDWVHIRELIAAEKAKGNN
Estimated Isoelectric Point:
6.85681915283203
Estimated Molecular Weight:
84.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr48
Lys51
Gln27
Leu73
Gly51
Met24
Ser54
Tyr15
His20
Glu39
Arg30
Cys14
Phe28
Pro18
Val57
Asn43
Ala51
Ile56
Trp17
Asp44