Sequence:
download
CE25569sequence.fasta
>LIN-17, isoform a MMHSLGIILLFIPLATGSIFDQAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFF ICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEITGGFSAPRLPTKGS SSSSSKPTGCPSDLVDVDPHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCV FYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKW VPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCR ERISFRTRGTDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVI SSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKNPIEPSTRPLLEPPTAPPPQPPVYMQMATNPQNSWRPSKVV
view sequence (558 aa)
>LIN-17, isoform a
MMHSLGIILLFIPLATGSIFDQAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFF
ICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEITGGFSAPRLPTKGS
SSSSSKPTGCPSDLVDVDPHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCV
FYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKW
VPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCR
ERISFRTRGTDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVI
SSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKNPIEPSTRPLLEPPTAPPPQPPVYMQMATNPQNSWRPSKVV
Estimated Isoelectric Point:
8.33220672607422
Estimated Molecular Weight:
62.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys25
Gln15
Leu49
Gly27
Met19
Ser51
Tyr13
His14
Glu19
Arg19
Cys30
Phe41
Pro44
Val31
Asn18
Ala38
Ile40
Trp12
Asp18