Sequence:
download
CE25338sequence.fasta
>SMU-2 MADNPTNLRNADFRKLLTSARSDRPAVSAFAKPADPKTGDDKPASFKHKHLKPAKFKKPQAAAHGKAKKEKTEADEDEAA LKNILKNYRDRAAERRKQGDEKEDPSKLTAAYRAVPGDARSAQDQADLRKQAILESKYLGGDLEHTHLVKGLDYSLLNKV RSEIDKSDDDDDDDIDTAFDEKVTSSSSSSKPSEASLLAQELAQSHSENRMVRSLHRVLFKNEVPLHNQLFAKGRMAYVV ELEDEETDIPTTLLRSLHDLPRAESAQSIQANNLIILKLSHVLSHLRAEPKKKKKEEFRVQLGSRDAPGAAAAAPGAKGD SIYDDLDDYVPSRKSRDSRDAGRRGSRRDRSRDRSRDRDRDRDRDNRDRYFEKSANSRREEEQNRREQQRERERAEQERR REREKEREQEKAKEREKKRKELEESSGYDECYPGGLVEMGGAWDSDEEADYSKMDAGPKKNQAVNRWDFDTEEEYASYME GREALPKAAYQYGVKNGEGGRKNKKQSAVSDAKRLDRELNEINKIMDKRKAGGDGAGGGGDYKKPKY
view sequence (547 aa)
>SMU-2
MADNPTNLRNADFRKLLTSARSDRPAVSAFAKPADPKTGDDKPASFKHKHLKPAKFKKPQAAAHGKAKKEKTEADEDEAA
LKNILKNYRDRAAERRKQGDEKEDPSKLTAAYRAVPGDARSAQDQADLRKQAILESKYLGGDLEHTHLVKGLDYSLLNKV
RSEIDKSDDDDDDDIDTAFDEKVTSSSSSSKPSEASLLAQELAQSHSENRMVRSLHRVLFKNEVPLHNQLFAKGRMAYVV
ELEDEETDIPTTLLRSLHDLPRAESAQSIQANNLIILKLSHVLSHLRAEPKKKKKEEFRVQLGSRDAPGAAAAAPGAKGD
SIYDDLDDYVPSRKSRDSRDAGRRGSRRDRSRDRSRDRDRDRDRDNRDRYFEKSANSRREEEQNRREQQRERERAEQERR
REREKEREQEKAKEREKKRKELEESSGYDECYPGGLVEMGGAWDSDEEADYSKMDAGPKKNQAVNRWDFDTEEEYASYME
GREALPKAAYQYGVKNGEGGRKNKKQSAVSDAKRLDRELNEINKIMDKRKAGGDGAGGGGDYKKPKY
Estimated Isoelectric Point:
8.71181488037109
Estimated Molecular Weight:
62.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys58
Gln19
Leu39
Gly32
Met7
Ser43
Tyr17
His11
Glu54
Arg58
Cys1
Phe10
Pro21
Val17
Asn20
Ala58
Ile11
Trp2
Asp57