Sequence:
download
CE25190sequence.fasta
>SQV-2 MRFYRTYLLVAGAFCSLCTLAVIFNCGWDDSPPATPSAINGGGSNAPLISSPTNLPETFLYISILTSPNETERRQNVRDT WFRLSTKGPSVFIAKFAVGTMGLAAEDRRLLAEENEKFGDLALLDRHEESYERLAKKTLACFVHAFANFKFKFFLKTDID SFVRITPLIINLKQIQDPMLYWGFLDGRAKPFRKGKWKEPEWNLCDRYLPYQLGGGYVLSYELIRFLAINAQLFRHYRNE DVSVGAWIGGLDVKYVHDPRFDTEWRSRGCNNEYLITHKHTEQEMQEMFENLKKTGKLCAKEFQKHPSYVYDFSKAPSEC CTRVNGSNIP
view sequence (330 aa)
>SQV-2
MRFYRTYLLVAGAFCSLCTLAVIFNCGWDDSPPATPSAINGGGSNAPLISSPTNLPETFLYISILTSPNETERRQNVRDT
WFRLSTKGPSVFIAKFAVGTMGLAAEDRRLLAEENEKFGDLALLDRHEESYERLAKKTLACFVHAFANFKFKFFLKTDID
SFVRITPLIINLKQIQDPMLYWGFLDGRAKPFRKGKWKEPEWNLCDRYLPYQLGGGYVLSYELIRFLAINAQLFRHYRNE
DVSVGAWIGGLDVKYVHDPRFDTEWRSRGCNNEYLITHKHTEQEMQEMFENLKKTGKLCAKEFQKHPSYVYDFSKAPSEC
CTRVNGSNIP
Estimated Isoelectric Point:
8.46967315673828
Estimated Molecular Weight:
38.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys21
Gln8
Leu33
Gly21
Met5
Ser19
Tyr14
His7
Glu22
Arg21
Cys9
Phe23
Pro17
Val14
Asn17
Ala22
Ile16
Trp7
Asp16