Sequence:
download
CE25181sequence.fasta
>BBS-1 MAKPVNVNQSKWTVPVLLKECEIYCPSTCVAFGPILSDNDSKLIIAHGGHRGVNMKLKVFQQLEQLSESSLADMPTALVH FINDLSSIPSIAVAAGPSLLIYKNLKPFYKFTVPSSAINPTESEAWKAVVNKKINGDTLLTVLKRLEDDVAFSKLTPISQ TYLRADKETQVVLVEHYGTKIANSATITCIAKLTKSTAEPLDILVIGTEHCEIFLIDSQAFTILETIKIGSVPVNICAYG TYDVDYRLFVQTRASLIFCMKRGEADYQPIVISQSMITSMVLVNKMIVYTTVENLIHFASFRGKKMNTVKCPSKIKMLEP FIYPLKQLAAVIAVFDKEIRMYNEHYLLDTVQYEKPLAWVKYGCYGREDSTLVVAFKDGSIAIQIFRRKANFDTKLDYNQ VPQAHALKLQIPKKTKVFIDLTQREVQLGNRIHKVYQKNLFDVKYRLAASYLELTSSASATVSTTTVLPVEISVDIHGFG PTFRMTIHLLSSSKQNLYDMHLSIISDPELYDFDTPLIPVHLLASGQSYSFTTLLYCKDPEKAANCDVRALLVHAKRATP IVTAVIKMPFSEFPLD
view sequence (576 aa)
>BBS-1
MAKPVNVNQSKWTVPVLLKECEIYCPSTCVAFGPILSDNDSKLIIAHGGHRGVNMKLKVFQQLEQLSESSLADMPTALVH
FINDLSSIPSIAVAAGPSLLIYKNLKPFYKFTVPSSAINPTESEAWKAVVNKKINGDTLLTVLKRLEDDVAFSKLTPISQ
TYLRADKETQVVLVEHYGTKIANSATITCIAKLTKSTAEPLDILVIGTEHCEIFLIDSQAFTILETIKIGSVPVNICAYG
TYDVDYRLFVQTRASLIFCMKRGEADYQPIVISQSMITSMVLVNKMIVYTTVENLIHFASFRGKKMNTVKCPSKIKMLEP
FIYPLKQLAAVIAVFDKEIRMYNEHYLLDTVQYEKPLAWVKYGCYGREDSTLVVAFKDGSIAIQIFRRKANFDTKLDYNQ
VPQAHALKLQIPKKTKVFIDLTQREVQLGNRIHKVYQKNLFDVKYRLAASYLELTSSASATVSTTTVLPVEISVDIHGFG
PTFRMTIHLLSSSKQNLYDMHLSIISDPELYDFDTPLIPVHLLASGQSYSFTTLLYCKDPEKAANCDVRALLVHAKRATP
IVTAVIKMPFSEFPLD
Estimated Isoelectric Point:
8.62465667724609
Estimated Molecular Weight:
64.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr41
Lys45
Gln21
Leu59
Gly19
Met13
Ser43
Tyr24
His14
Glu26
Arg17
Cys11
Phe25
Pro29
Val48
Asn21
Ala42
Ile46
Trp3
Asp29