Sequence:
download
CE25143sequence.fasta
>RAD-54.L MPKKTFENLEDSHGKDVNIPVELPKRKREVTPENLPSTSSTAPTQKRKSLGYSGRTEEPKNIHKTFISPFSTSVSPSKQG LRRRKKALPAIEPPVSVEEASPLRFVNIDVFSRRMASESSDHDAMIAKLLSRKFSIPMEGYMLSGRSLGLGGNRRKCALF DPYHEGALILYAPEHLSEHAQLKEDKDRKVHVVADPVVGKILRPHQRDGVKFMWDCVTGINIPEFHGCIMADEMGLGKTL QCISLLWTLLRQSPDACPTVSKSIIVCPSSLVKNWDKEIKKWLGTRLNAMPVDSGKREQIIACLNSFMADSKMRCAIPVL IISYETFRLYANILHSGDVGIVICDEGHRLKNSENLTYQALSGLKCARRVLISGTPIQNDLLEYFSLVNFVNPGLLGTAS EFRKKFENAILKGRDADASSEDQKKGEEKTKEMISLVEKCIIRRTSALLTKYLPVKYEHIICCKNSTLQETLYNKLIECE KQNRIVEKDKGATASALSFITHLKKLCNHPYLVYDEFQKPDNRFRNKCLSIFPESFNPKSFDPSFSGKMKVLDYILAVTR KTTDDKFVLVSNYTQTIDQFMELCKLRGYDFVRLDGSMSIKQRSKIVDTFNDPASTIFCFLLSSKAGGCGLNLIGANRLV MFDPDWNPANDDQAMARVWRDGQKKMCFIYRLLATGSIEEKMFQRQTHKKALSSCVVDAGEDVARHFSSEQLRELFKLES TVASDTHEKLKCKRCIQGVESVDPPTNADCASDLSNWFHSQKSARKVADNVLRAVFECGSISFVFHQKSHNVEVKKVQEK VEEVDEDYVPSEAEENDD
view sequence (818 aa)
>RAD-54.L
MPKKTFENLEDSHGKDVNIPVELPKRKREVTPENLPSTSSTAPTQKRKSLGYSGRTEEPKNIHKTFISPFSTSVSPSKQG
LRRRKKALPAIEPPVSVEEASPLRFVNIDVFSRRMASESSDHDAMIAKLLSRKFSIPMEGYMLSGRSLGLGGNRRKCALF
DPYHEGALILYAPEHLSEHAQLKEDKDRKVHVVADPVVGKILRPHQRDGVKFMWDCVTGINIPEFHGCIMADEMGLGKTL
QCISLLWTLLRQSPDACPTVSKSIIVCPSSLVKNWDKEIKKWLGTRLNAMPVDSGKREQIIACLNSFMADSKMRCAIPVL
IISYETFRLYANILHSGDVGIVICDEGHRLKNSENLTYQALSGLKCARRVLISGTPIQNDLLEYFSLVNFVNPGLLGTAS
EFRKKFENAILKGRDADASSEDQKKGEEKTKEMISLVEKCIIRRTSALLTKYLPVKYEHIICCKNSTLQETLYNKLIECE
KQNRIVEKDKGATASALSFITHLKKLCNHPYLVYDEFQKPDNRFRNKCLSIFPESFNPKSFDPSFSGKMKVLDYILAVTR
KTTDDKFVLVSNYTQTIDQFMELCKLRGYDFVRLDGSMSIKQRSKIVDTFNDPASTIFCFLLSSKAGGCGLNLIGANRLV
MFDPDWNPANDDQAMARVWRDGQKKMCFIYRLLATGSIEEKMFQRQTHKKALSSCVVDAGEDVARHFSSEQLRELFKLES
TVASDTHEKLKCKRCIQGVESVDPPTNADCASDLSNWFHSQKSARKVADNVLRAVFECGSISFVFHQKSHNVEVKKVQEK
VEEVDEDYVPSEAEENDD
Estimated Isoelectric Point:
8.67058563232422
Estimated Molecular Weight:
92.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys73
Gln25
Leu74
Gly40
Met19
Ser73
Tyr18
His20
Glu56
Arg46
Cys25
Phe37
Pro38
Val53
Asn35
Ala47
Ile46
Trp7
Asp50