Sequence:
download
CE25124sequence.fasta
>DAT-1 MQLVPTDDPDEKIGRTSNGMQNATLPIDGPVNTEPKDPAREQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLI PYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWAS CNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVV YLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFG VLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFW SVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILKKNREVFVGCLFAFYMVIGIAMCTEGGILIMEWLIIYGTTWGLLIA VFCEAMVIAYIYGLRQFVHDVKEMMGFRPGNYWKFCWSCAAPFILLSMITSNFINYQALTYQDYTYPTAANVIGIIFALS GASFIPLVGIYKFVNARGNTISEKWQRVTMPYRKRPNQTEYIPIPTTQPHSDIML
view sequence (615 aa)
>DAT-1
MQLVPTDDPDEKIGRTSNGMQNATLPIDGPVNTEPKDPAREQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLI
PYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWAS
CNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVV
YLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFG
VLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFW
SVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILKKNREVFVGCLFAFYMVIGIAMCTEGGILIMEWLIIYGTTWGLLIA
VFCEAMVIAYIYGLRQFVHDVKEMMGFRPGNYWKFCWSCAAPFILLSMITSNFINYQALTYQDYTYPTAANVIGIIFALS
GASFIPLVGIYKFVNARGNTISEKWQRVTMPYRKRPNQTEYIPIPTTQPHSDIML
Estimated Isoelectric Point:
5.95191192626953
Estimated Molecular Weight:
69.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr32
Lys20
Gln15
Leu57
Gly51
Met21
Ser42
Tyr37
His8
Glu24
Arg18
Cys15
Phe47
Pro34
Val45
Asn28
Ala40
Ile45
Trp17
Asp19