Sequence:
download
CE25109sequence.fasta
>MTL-2 MVCKCDCKNQNCSCNTGTKDCDCSDAKCCEQYCCPTASEKKCCKSGCAGGCKCANCECAQAAH
view sequence (63 aa)
>MTL-2
MVCKCDCKNQNCSCNTGTKDCDCSDAKCCEQYCCPTASEKKCCKSGCAGGCKCANCECAQAAH
Estimated Isoelectric Point:
7.31098175048828
Estimated Molecular Weight:
6.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr3
Lys8
Gln3
Gly4
Met1
Ser4
Tyr1
His1
Glu3
Cys18
Pro1
Val1
Asn4
Ala7
Asp4