Sequence:
download
CE25099sequence.fasta
>ACR-14 MSFVFFILLTFYIQVKGSVDEYRLLQYLKENYDSFERPVENSSAPLDVKVRFLLNQIMDVDEKNQVMSILAYMDYHWNDY KLTWDPKLFGGIRDVRFSGDDDASFKLWRPDVLLFNSVSESFDSTYSSRFIVSSNGDVQQNPPGIFRFVCQIDVTYYPFD KQTCFLKLGSWTYNGQYINLDFLLTQIIGLHGIPIVVEPERSSTNYASYFVNESIDLQVYLQNGEWDLEGTPGKRVVQKF GTDEYHELYFYIHIRRRTLAYGINLIIPSLVISMMTILGFTLPPDACEKITLETTVLLSVIFFLQMVSSTSPPQSQSVPI LAAFFSCCLMLVACSCVFTVLTLSLHHRKPETHEMSPTMRKIFIDWLPYILCMCKPDHPKTPKPKVLGKSIAPIHRLSTI PMLNLPRVSQTTFPDKNVFVYHEVPAVIKNTSRICAELLIIERDIEKMLDKIEEDTKEDMLRSEWRFAAMAVDRLCLYVF SAFITMITCGLIVPHILANI
view sequence (500 aa)
>ACR-14
MSFVFFILLTFYIQVKGSVDEYRLLQYLKENYDSFERPVENSSAPLDVKVRFLLNQIMDVDEKNQVMSILAYMDYHWNDY
KLTWDPKLFGGIRDVRFSGDDDASFKLWRPDVLLFNSVSESFDSTYSSRFIVSSNGDVQQNPPGIFRFVCQIDVTYYPFD
KQTCFLKLGSWTYNGQYINLDFLLTQIIGLHGIPIVVEPERSSTNYASYFVNESIDLQVYLQNGEWDLEGTPGKRVVQKF
GTDEYHELYFYIHIRRRTLAYGINLIIPSLVISMMTILGFTLPPDACEKITLETTVLLSVIFFLQMVSSTSPPQSQSVPI
LAAFFSCCLMLVACSCVFTVLTLSLHHRKPETHEMSPTMRKIFIDWLPYILCMCKPDHPKTPKPKVLGKSIAPIHRLSTI
PMLNLPRVSQTTFPDKNVFVYHEVPAVIKNTSRICAELLIIERDIEKMLDKIEEDTKEDMLRSEWRFAAMAVDRLCLYVF
SAFITMITCGLIVPHILANI
Estimated Isoelectric Point:
5.71500396728516
Estimated Molecular Weight:
57.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys24
Gln17
Leu53
Gly18
Met16
Ser39
Tyr22
His11
Glu25
Arg22
Cys12
Phe32
Pro29
Val38
Asn18
Ala17
Ile41
Trp7
Asp30