Sequence:
download
CE25058sequence.fasta
>SLI-1, isoform a MGSINTIFHRIHRFVNGTGNNARFVPSTNNSTEALTLSPRAVPSTVSLFEIPSASEMPGFCSEEDRRFLLKACKFMDQVV KSCHSPRLNLKNSPPFILDILPDTYTHLMLIFTQNNDILQDNDYLKIFLESMINKCKEIIKLFKTSAIYNDQSEERRKLT KMSLTFSHMLFEIKALFPEGIYIEDRFRMTKKEAESFWSHHFTKKNIVPWSTFFTALEKHHGSTIGKMEAAELKATIDLS GDDFISNFEFDVFTRLFYPFKTLIKNWQTLTTAHPGYCAFLTYDEVKKRLEKLTKKPGSYIFRLSCTRPGQWAIGYVAPD GKIYQTIPQNKSLIQALHEGHKEGFYIYPNGRDQDINLSKLMDVPQADRVQVTSEQYELYCEMGTTFELCKICDDNEKNI KIEPCGHLLCAKCLANWQDSDGGGNTCPFCRYEIKGTNRVIIDRFKPTPVEIEKAKNVAAAEKKLISLVPDVPPRTYVSQ CSQSLLHDASNSIPSVDELPLVPPPLPPKALGTLDTLNSSQTSSSYVNIKELENVETSGEALAQVVNRQRAPSIQAPPLP PRLSASEHQPHHPYTNTNSERE
view sequence (582 aa)
>SLI-1, isoform a
MGSINTIFHRIHRFVNGTGNNARFVPSTNNSTEALTLSPRAVPSTVSLFEIPSASEMPGFCSEEDRRFLLKACKFMDQVV
KSCHSPRLNLKNSPPFILDILPDTYTHLMLIFTQNNDILQDNDYLKIFLESMINKCKEIIKLFKTSAIYNDQSEERRKLT
KMSLTFSHMLFEIKALFPEGIYIEDRFRMTKKEAESFWSHHFTKKNIVPWSTFFTALEKHHGSTIGKMEAAELKATIDLS
GDDFISNFEFDVFTRLFYPFKTLIKNWQTLTTAHPGYCAFLTYDEVKKRLEKLTKKPGSYIFRLSCTRPGQWAIGYVAPD
GKIYQTIPQNKSLIQALHEGHKEGFYIYPNGRDQDINLSKLMDVPQADRVQVTSEQYELYCEMGTTFELCKICDDNEKNI
KIEPCGHLLCAKCLANWQDSDGGGNTCPFCRYEIKGTNRVIIDRFKPTPVEIEKAKNVAAAEKKLISLVPDVPPRTYVSQ
CSQSLLHDASNSIPSVDELPLVPPPLPPKALGTLDTLNSSQTSSSYVNIKELENVETSGEALAQVVNRQRAPSIQAPPLP
PRLSASEHQPHHPYTNTNSERE
Estimated Isoelectric Point:
6.98189544677734
Estimated Molecular Weight:
66.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr40
Lys42
Gln21
Leu52
Gly24
Met11
Ser46
Tyr18
His17
Glu40
Arg25
Cys15
Phe31
Pro40
Val25
Asn32
Ala31
Ile39
Trp5
Asp28