Sequence:
download
CE25046sequence.fasta
>CMK-1 MPLFKRRDGSGPAPNATIREKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNN IVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSK IMISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFD APYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYTHDIHGTVAVHLKKSLAKRNWKKAYNAAAAIRQLQM LRLSSNSNRLQKQASQQQPEPPTPAFHA
view sequence (348 aa)
>CMK-1
MPLFKRRDGSGPAPNATIREKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNN
IVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSK
IMISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFD
APYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYTHDIHGTVAVHLKKSLAKRNWKKAYNAAAAIRQLQM
LRLSSNSNRLQKQASQQQPEPPTPAFHA
Estimated Isoelectric Point:
6.01717376708984
Estimated Molecular Weight:
39.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys26
Gln18
Leu29
Gly21
Met8
Ser22
Tyr16
His9
Glu20
Arg14
Cys6
Phe15
Pro16
Val21
Asn14
Ala32
Ile18
Trp4
Asp25