Sequence:
download
CE24913sequence.fasta
>F22D6.9 MSGIEFEARMKPGTPDDLKKLHSWLESIIFRYFHVWSPVNCQDMLKRYEIYELCLRARELFWTQPLYRHVEVPVTIVGDI HGQFEDLKMMMDMNGWPFTEDEAKEMCKNLLLKGGKDGKQTFPAVLGSGTDRQKTQKNYLFLGDYVDRGPYSIEVVLMLF AMHLRWPDRVTLLRGNHESRPVNRQYGFYGECVRRYSERIYEVFQLAFNAMPLTAIVNKRIMCMHGGISEELFDLKQLDA LKRPIDTPDIGIIADLTWADPECEIDYYKESPRGAGKIFGAKAVDEFCKHFQLDLIVRAHQVVQDGYEFFADRKLVTIFS APFYCGQTNNIASMLNIDKDMVASFMLVKPVTEIKENQNVGEKADDEN
view sequence (368 aa)
>F22D6.9
MSGIEFEARMKPGTPDDLKKLHSWLESIIFRYFHVWSPVNCQDMLKRYEIYELCLRARELFWTQPLYRHVEVPVTIVGDI
HGQFEDLKMMMDMNGWPFTEDEAKEMCKNLLLKGGKDGKQTFPAVLGSGTDRQKTQKNYLFLGDYVDRGPYSIEVVLMLF
AMHLRWPDRVTLLRGNHESRPVNRQYGFYGECVRRYSERIYEVFQLAFNAMPLTAIVNKRIMCMHGGISEELFDLKQLDA
LKRPIDTPDIGIIADLTWADPECEIDYYKESPRGAGKIFGAKAVDEFCKHFQLDLIVRAHQVVQDGYEFFADRKLVTIFS
APFYCGQTNNIASMLNIDKDMVASFMLVKPVTEIKENQNVGEKADDEN
Estimated Isoelectric Point:
5.58426666259766
Estimated Molecular Weight:
42.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys24
Gln14
Leu32
Gly24
Met16
Ser13
Tyr15
His9
Glu27
Arg21
Cys8
Phe21
Pro17
Val24
Asn14
Ala20
Ile22
Trp6
Asp27