Sequence:
download
CE24910sequence.fasta
>GPR-1 MDVSYYDGPKDEVAEAMLKSAVTAMRLGQYEDGKGRLEEIMEFGTSNFQLLGTIYMYYGRVCRHLNHDAKALEFFEHELN MFKLIFNYPEACDSTRRIVEQALKMGKFPKARRFAEDLIDYTSNKKNGEKYIGQARILFASVCLEGCERDVESNQDEKKK LLSICAEQIAAVKLFNENNTEGAVSETKIMLLEAKCLSLDEKYEESRRKYQECIDFAIKTDQFEAVHIAYYDKALYAETD LLFFIIRDLRSALFYATKFGKERDVVKYKSKLSEEMLRNGEFHEAYLYGLEALVSIRKLGLNEYIGDVLLTIAKCLIALG KRRQAAYFIILGSVLTINQNSFKLFYEQIDVAMNQERSETATDQDVCLAIDSSPDPTSSNDMINKFVVELEHATNVETWE MIVNGIIDDQKKPVAIEKKENEEPVDMMDLIFSMSSRMDDQRTELPAARFIPPRPVSSASKKTTKSHRILPGLRANWTKV QSMKFDGHTMNRILKRSKKSKSSLDSTNSMQGDDTRSDDVTMTSK
view sequence (525 aa)
>GPR-1
MDVSYYDGPKDEVAEAMLKSAVTAMRLGQYEDGKGRLEEIMEFGTSNFQLLGTIYMYYGRVCRHLNHDAKALEFFEHELN
MFKLIFNYPEACDSTRRIVEQALKMGKFPKARRFAEDLIDYTSNKKNGEKYIGQARILFASVCLEGCERDVESNQDEKKK
LLSICAEQIAAVKLFNENNTEGAVSETKIMLLEAKCLSLDEKYEESRRKYQECIDFAIKTDQFEAVHIAYYDKALYAETD
LLFFIIRDLRSALFYATKFGKERDVVKYKSKLSEEMLRNGEFHEAYLYGLEALVSIRKLGLNEYIGDVLLTIAKCLIALG
KRRQAAYFIILGSVLTINQNSFKLFYEQIDVAMNQERSETATDQDVCLAIDSSPDPTSSNDMINKFVVELEHATNVETWE
MIVNGIIDDQKKPVAIEKKENEEPVDMMDLIFSMSSRMDDQRTELPAARFIPPRPVSSASKKTTKSHRILPGLRANWTKV
QSMKFDGHTMNRILKRSKKSKSSLDSTNSMQGDDTRSDDVTMTSK
Estimated Isoelectric Point:
5.65668487548828
Estimated Molecular Weight:
60.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys45
Gln17
Leu47
Gly23
Met20
Ser38
Tyr21
His8
Glu47
Arg29
Cys9
Phe24
Pro12
Val26
Asn23
Ala39
Ile33
Trp2
Asp36