Sequence:
download
CE24692sequence.fasta
>GPA-16, isoform a MGCIMSQEDEAAKRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILS LNAIIHAMEQLKISFTTLDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLD RICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQT NRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMNKRTTGEKNQ EIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
view sequence (357 aa)
>GPA-16, isoform a
MGCIMSQEDEAAKRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILS
LNAIIHAMEQLKISFTTLDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLD
RICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQT
NRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMNKRTTGEKNQ
EIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
Estimated Isoelectric Point:
5.32033538818359
Estimated Molecular Weight:
41.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys23
Gln15
Leu34
Gly17
Met10
Ser22
Tyr13
His5
Glu31
Arg23
Cys9
Phe17
Pro5
Val19
Asn16
Ala16
Ile29
Trp3
Asp24