Sequence:
download
CE23857sequence.fasta
>NPP-1, isoform b MSLFGSSTPQKQAFTFPTPNAPTTSSGTLFGSTTPSKPLFGSTAQASSTPSLFGTTNTSTPSGGLFGKTGTSTTTTSTAG TLFGAAPTTSTATPSLFGASTTGSTPFGAASTGTAAGSTLFGSSTAKPATGGFFGSSSGSTLGGLGATQQQQQPVVQQQQ VIQQYHPFVKAVGDPKLFGNDNDGVVAKLNQVAAGLGVGKAPYKDGNQLLSFSMEGNLFERFVGIGYNRISERTDDEGFV TLVLRHPITNLNTEERRDKILEIIKAILGGGPNVEVRYAPGTSMRTLSDGCTEICIIAKEGGFVAGAIKLAQILNDAPKM TQLESQLQVDKTRVLPKVGMSKAQRDRYLETVPDGIDERIWRQAIKENPAPNKLLPVPVRGWEALRDRQKAQVGESKLFH EAINALGNRVEEANHEHADAVVKMEIIRNRHKTLSYRIVRVMLAQWIVSRYSRQIDTDEDVIEAKADTLLAQMNRHNQVK FYVDKFYEILESKPDKLQESMWKMFDMTIEDEHYARRVLTKFVNICSGLYESTHQQIESLEACRRALEG
view sequence (549 aa)
>NPP-1, isoform b
MSLFGSSTPQKQAFTFPTPNAPTTSSGTLFGSTTPSKPLFGSTAQASSTPSLFGTTNTSTPSGGLFGKTGTSTTTTSTAG
TLFGAAPTTSTATPSLFGASTTGSTPFGAASTGTAAGSTLFGSSTAKPATGGFFGSSSGSTLGGLGATQQQQQPVVQQQQ
VIQQYHPFVKAVGDPKLFGNDNDGVVAKLNQVAAGLGVGKAPYKDGNQLLSFSMEGNLFERFVGIGYNRISERTDDEGFV
TLVLRHPITNLNTEERRDKILEIIKAILGGGPNVEVRYAPGTSMRTLSDGCTEICIIAKEGGFVAGAIKLAQILNDAPKM
TQLESQLQVDKTRVLPKVGMSKAQRDRYLETVPDGIDERIWRQAIKENPAPNKLLPVPVRGWEALRDRQKAQVGESKLFH
EAINALGNRVEEANHEHADAVVKMEIIRNRHKTLSYRIVRVMLAQWIVSRYSRQIDTDEDVIEAKADTLLAQMNRHNQVK
FYVDKFYEILESKPDKLQESMWKMFDMTIEDEHYARRVLTKFVNICSGLYESTHQQIESLEACRRALEG
Estimated Isoelectric Point:
8.46337127685547
Estimated Molecular Weight:
59.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr52
Lys30
Gln31
Leu43
Gly50
Met11
Ser43
Tyr11
His9
Glu32
Arg28
Cys4
Phe25
Pro27
Val33
Asn21
Ala45
Ile27
Trp4
Asp23