Sequence:
download
CE23586sequence.fasta
>SRI-25 MDLNIDFEVPNFLIHHYYASGSISVLLNGLVIYLLIFHNGKIGSFKFYLLSFQISCVLLDLHVTMLMQPVGLLPICAGYS NGILSKVFKLHSHILMTLFVFFLSLQINTLIICFLRKHKAIMNLRSTSSVPNWIYHVLLGMIVFLIWSLTFTLSMSSESY EKQLEMLDIFHPLVSTKFRNLPEFQYYYLNTWMLIFFTLTIFETMKSFLMVSGTVTQMYRALKEVECQLSSQTLAKHKSA LRSLIAQFATTPVAILPGGMIACTVIFPTEYSQKISWCCMMVMTTHSTLNSLVVILTYPEFRKIVCFWDKSVKKSTAVAT VII
view sequence (323 aa)
>SRI-25
MDLNIDFEVPNFLIHHYYASGSISVLLNGLVIYLLIFHNGKIGSFKFYLLSFQISCVLLDLHVTMLMQPVGLLPICAGYS
NGILSKVFKLHSHILMTLFVFFLSLQINTLIICFLRKHKAIMNLRSTSSVPNWIYHVLLGMIVFLIWSLTFTLSMSSESY
EKQLEMLDIFHPLVSTKFRNLPEFQYYYLNTWMLIFFTLTIFETMKSFLMVSGTVTQMYRALKEVECQLSSQTLAKHKSA
LRSLIAQFATTPVAILPGGMIACTVIFPTEYSQKISWCCMMVMTTHSTLNSLVVILTYPEFRKIVCFWDKSVKKSTAVAT
VII
Estimated Isoelectric Point:
9.02733612060547
Estimated Molecular Weight:
37.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys17
Gln10
Leu46
Gly11
Met16
Ser31
Tyr13
His11
Glu10
Arg6
Cys8
Phe24
Pro10
Val24
Asn11
Ala12
Ile29
Trp5
Asp5