Sequence:
download
CE23555sequence.fasta
>RAB-3, isoform a MNNQQAAIASARSRMAAGGQPQGATPGQPDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFR GDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVS MDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKDPQQQPKGQKLEANPTQKPAQQQCNC
view sequence (233 aa)
>RAB-3, isoform a
MNNQQAAIASARSRMAAGGQPQGATPGQPDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFR
GDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVS
MDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKDPQQQPKGQKLEANPTQKPAQQQCNC
Estimated Isoelectric Point:
5.67644500732422
Estimated Molecular Weight:
26.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys16
Gln21
Leu12
Gly15
Met8
Ser15
Tyr7
Glu12
Arg11
Cys6
Phe13
Pro7
Val15
Asn12
Ala18
Ile12
Trp3
Asp16