Sequence:
download
CE23548sequence.fasta
>EIF-2BGAMMA MHEMQGILLCSGGGTRMPVLTRHVQKCLLPVVGVPMFLYPLSSLLRTGITDIKIFVREVLQLTLEKEVKKSKLLEKYPAH IEYICVNQEDFGTADLLKNHHSKITKDALIVSCDFISDASLIPLVDFFRATNSTLVALIADTCVNAPAPGSKSKKPKATD VMAIVESTGQLAFLCGDDDFDAPLVMEKSLKIFPSIKLTSKYNDCHVYAIRHKVLLNLSKSKHISSFKADFVPLLIDKQF EPDSDIKCFAYRLPHENGFVTAHANTLGSYFEVNKAIQKSFTRLMEYRGNGKNFNYKTDKIAAHESRIEESAEIDKDSVI KRSFISDNCRIGEKTKLKESIIAKGVVIGNGASISNSIICDGVEIGENADVTNCIVAKDQKVPAKGKVQNEVVEDGEDEE WTDD
view sequence (404 aa)
>EIF-2BGAMMA
MHEMQGILLCSGGGTRMPVLTRHVQKCLLPVVGVPMFLYPLSSLLRTGITDIKIFVREVLQLTLEKEVKKSKLLEKYPAH
IEYICVNQEDFGTADLLKNHHSKITKDALIVSCDFISDASLIPLVDFFRATNSTLVALIADTCVNAPAPGSKSKKPKATD
VMAIVESTGQLAFLCGDDDFDAPLVMEKSLKIFPSIKLTSKYNDCHVYAIRHKVLLNLSKSKHISSFKADFVPLLIDKQF
EPDSDIKCFAYRLPHENGFVTAHANTLGSYFEVNKAIQKSFTRLMEYRGNGKNFNYKTDKIAAHESRIEESAEIDKDSVI
KRSFISDNCRIGEKTKLKESIIAKGVVIGNGASISNSIICDGVEIGENADVTNCIVAKDQKVPAKGKVQNEVVEDGEDEE
WTDD
Estimated Isoelectric Point:
6.28452301025391
Estimated Molecular Weight:
44.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr20
Lys39
Gln9
Leu35
Gly22
Met7
Ser31
Tyr9
His11
Glu26
Arg12
Cys11
Phe18
Pro15
Val31
Asn18
Ala27
Ile33
Trp1
Asp29