Sequence:
download
CE23341sequence.fasta
>UAF-2, isoform a MSYGDGLSGAEYLASIYGTEKDKVNCSFFFKTGACRHGDKCSRAHHTPTFSPTVVLKNFYHNPVVDVRQADAFDKVGKRN DQEQRYFDDFYEEVFVEMERKYGEVEEINVCENIGEHMVGNVYVKFMKEEDAEKAKNDLNNRWFNGQPIYAELCPVTDFR ESRCRQHEVTTCSKGGFCNFMHLKAISAELGDRLYGRRGRRADAAGHYPSQRGGSGGGGGGGGGGGYGSGGGWGGGGGGR DRDRGGWGGGGGGRGYGGGGGGGGYGYGGGGGGRRRSRSRDRRRY
view sequence (285 aa)
>UAF-2, isoform a
MSYGDGLSGAEYLASIYGTEKDKVNCSFFFKTGACRHGDKCSRAHHTPTFSPTVVLKNFYHNPVVDVRQADAFDKVGKRN
DQEQRYFDDFYEEVFVEMERKYGEVEEINVCENIGEHMVGNVYVKFMKEEDAEKAKNDLNNRWFNGQPIYAELCPVTDFR
ESRCRQHEVTTCSKGGFCNFMHLKAISAELGDRLYGRRGRRADAAGHYPSQRGGSGGGGGGGGGGGYGSGGGWGGGGGGR
DRDRGGWGGGGGGRGYGGGGGGGGYGYGGGGGGRRRSRSRDRRRY
Estimated Isoelectric Point:
8.81616973876953
Estimated Molecular Weight:
30.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys14
Gln6
Leu8
Gly64
Met5
Ser14
Tyr16
His8
Glu19
Arg28
Cys8
Phe14
Pro6
Val16
Asn12
Ala14
Ile5
Trp3
Asp17