Sequence:
download
CE23280sequence.fasta
>DCS-1, isoform a MKRIADEELVREERAEESTQKWLQDAKFQEILGADSSHKSLFVLLSHPDGSQGILLANKSPFSEEKSDIEKLLATAQLQE ISRNDIFGSYNIEIDPKLNLLKSQLIYPINDRLIAKYRQEEKFVIRETPELYETVTRPYIEKYQLNLNWVYNCLEKRSEV DKIVFEDPDNENGFVLLQDIKWDGKTLENLYVLAICHRHGLKSVRDLTGDDLEMLYNMRDKSLEAINQKYGLKTDQIKCY FHYQPSFYHLHVHFINLKYDAPASTTMSAILLDDVINNLELNPEHYKKSTLTFTRKNGDKLMEMFREALKN
view sequence (311 aa)
>DCS-1, isoform a
MKRIADEELVREERAEESTQKWLQDAKFQEILGADSSHKSLFVLLSHPDGSQGILLANKSPFSEEKSDIEKLLATAQLQE
ISRNDIFGSYNIEIDPKLNLLKSQLIYPINDRLIAKYRQEEKFVIRETPELYETVTRPYIEKYQLNLNWVYNCLEKRSEV
DKIVFEDPDNENGFVLLQDIKWDGKTLENLYVLAICHRHGLKSVRDLTGDDLEMLYNMRDKSLEAINQKYGLKTDQIKCY
FHYQPSFYHLHVHFINLKYDAPASTTMSAILLDDVINNLELNPEHYKKSTLTFTRKNGDKLMEMFREALKN
Estimated Isoelectric Point:
5.48749542236328
Estimated Molecular Weight:
36.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys27
Gln13
Leu40
Gly10
Met6
Ser19
Tyr15
His9
Glu29
Arg14
Cys3
Phe12
Pro10
Val12
Asn19
Ala14
Ile21
Trp3
Asp22