Sequence:
download
CE22986sequence.fasta
>TBX-40 MIQQAQFNVQMAEEDRWLTQYPNMEMIVNNKGPKPIFPELNFNITGLEEKSRYVVLLSIQKFDNIRYGFKNGKWGPSKVR HATKKEQEIKYFLHPDGTKLGEELMKETIKFDTVRITNHKKFMDKDNVFFVETMHKYVPVLTVKNITNVESANHSMRMEV AQFFPVTVYNQESIGNWKSKFHKNATFENRLDGGNKRKNTNSREEPSSKRSKNETEIAVLDILQVASQSENYNESTNSGR LQNEISSSIHQFPSTSYQNQYPHAYPTVNTPPIYAQQFPAPFDEKQNQFYPKTDENLAPNCAQDASSLPNFAMNQKASFA NQYPYHPYYHQYSQLDHGSPYQYMNNSINSDSSFQSSFSTENSYFDDNGNPIHYPYYPYK
view sequence (380 aa)
>TBX-40
MIQQAQFNVQMAEEDRWLTQYPNMEMIVNNKGPKPIFPELNFNITGLEEKSRYVVLLSIQKFDNIRYGFKNGKWGPSKVR
HATKKEQEIKYFLHPDGTKLGEELMKETIKFDTVRITNHKKFMDKDNVFFVETMHKYVPVLTVKNITNVESANHSMRMEV
AQFFPVTVYNQESIGNWKSKFHKNATFENRLDGGNKRKNTNSREEPSSKRSKNETEIAVLDILQVASQSENYNESTNSGR
LQNEISSSIHQFPSTSYQNQYPHAYPTVNTPPIYAQQFPAPFDEKQNQFYPKTDENLAPNCAQDASSLPNFAMNQKASFA
NQYPYHPYYHQYSQLDHGSPYQYMNNSINSDSSFQSSFSTENSYFDDNGNPIHYPYYPYK
Estimated Isoelectric Point:
6.87497711181641
Estimated Molecular Weight:
44.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr20
Lys29
Gln26
Leu16
Gly13
Met11
Ser33
Tyr24
His12
Glu26
Arg11
Cys1
Phe23
Pro25
Val18
Asn39
Ala17
Ile18
Trp3
Asp15