Sequence:
download
CE22926sequence.fasta
>MAB-20, isoform a MRNFLVFSVIFIAYNSCEAANIQADNTFADPNIGEFRELLIDPKAGALFVGSEGAIFRLWAYNINDTGENVFAKKQLVLS ESEESECRSTASDERLCRPSTRFLAFTNNLDSIYVCSSVGMRPEIRVLDSLSLRDQQEPRTEIGICVVDPTFNFTAVVVD SGNPEDATSVYSGIRTGMGGENHLIYRPPLTKNGKQLHASIRTIYSDNKWLNEPQFVGSFDVGQHVFFFFREIAHDNSFG ERIVHSRVARVCKKDIGGRNVLRQVWTSFVKARLNCSVSANFPFYFDHIQSVKRVDKHGETYFYATFSTSETAFTSSAIC MFQLSSINHLLDTGLLMEETANGQFSVTADEIPAHRPGTCSQNSHSISDTDLHFAKTHLLVSDSISGGTPILPLRDHVFT HIVVDQLPNQNVIFAFDSANRRVWKISHWKEGNEWKSNLIEEKSLKIAASRINDVALLPAEFFFVTSGAGVSQFSVARCS EQPSCALCSLDPYCSWNAVNSKCSLKTKTNEKSVGWISSSWAGRISPECSAVEKLTVKDVYLGDGLRLVGAKNGVWQKDG RSVESGQRHVVTRNGELVVLDAQLEDAGTYECLRDNIILVRARIVVHENCARPTSVAEYRSCQREWCKKADAYKAALNIW SDSNKKNVQCKANTSSAH
view sequence (658 aa)
>MAB-20, isoform a
MRNFLVFSVIFIAYNSCEAANIQADNTFADPNIGEFRELLIDPKAGALFVGSEGAIFRLWAYNINDTGENVFAKKQLVLS
ESEESECRSTASDERLCRPSTRFLAFTNNLDSIYVCSSVGMRPEIRVLDSLSLRDQQEPRTEIGICVVDPTFNFTAVVVD
SGNPEDATSVYSGIRTGMGGENHLIYRPPLTKNGKQLHASIRTIYSDNKWLNEPQFVGSFDVGQHVFFFFREIAHDNSFG
ERIVHSRVARVCKKDIGGRNVLRQVWTSFVKARLNCSVSANFPFYFDHIQSVKRVDKHGETYFYATFSTSETAFTSSAIC
MFQLSSINHLLDTGLLMEETANGQFSVTADEIPAHRPGTCSQNSHSISDTDLHFAKTHLLVSDSISGGTPILPLRDHVFT
HIVVDQLPNQNVIFAFDSANRRVWKISHWKEGNEWKSNLIEEKSLKIAASRINDVALLPAEFFFVTSGAGVSQFSVARCS
EQPSCALCSLDPYCSWNAVNSKCSLKTKTNEKSVGWISSSWAGRISPECSAVEKLTVKDVYLGDGLRLVGAKNGVWQKDG
RSVESGQRHVVTRNGELVVLDAQLEDAGTYECLRDNIILVRARIVVHENCARPTSVAEYRSCQREWCKKADAYKAALNIW
SDSNKKNVQCKANTSSAH
Estimated Isoelectric Point:
6.53691864013672
Estimated Molecular Weight:
73.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr34
Lys31
Gln21
Leu47
Gly37
Met5
Ser68
Tyr14
His18
Glu39
Arg39
Cys20
Phe36
Pro21
Val54
Asn40
Ala50
Ile37
Trp12
Asp35