Sequence:
download
CE22543sequence.fasta
>DCAP-1 MSDAKKKAAAELAAKNLAQLQKIDIAASKILDKMPFAAIYHIDAARKEWNQSNCEGTFFVYQRADRPYFSFLIANRNDPS DFIEPLTLNHILRHDGNFIYFYKDLASIQALWFHQIDDAQKIYNLLQKLVNRLKGSTTEQARAAKAASEAPQASVPAPTQ APAAPAQAPQMAPQAPPKVDLLQLIKSAQNPPQKSAATIEQMPPMLQKLMLKEPGAAMSADELEKDLIKSAKPHRNHLLQ EFTNSTSAISLAAVSTKPLHGSEGDVESDIAEGEILEPLDASFVVGSGEQTPVLNKEQFISAIAHLMQTDDEFVSQIHQA YVSALNRRLNID
view sequence (332 aa)
>DCAP-1
MSDAKKKAAAELAAKNLAQLQKIDIAASKILDKMPFAAIYHIDAARKEWNQSNCEGTFFVYQRADRPYFSFLIANRNDPS
DFIEPLTLNHILRHDGNFIYFYKDLASIQALWFHQIDDAQKIYNLLQKLVNRLKGSTTEQARAAKAASEAPQASVPAPTQ
APAAPAQAPQMAPQAPPKVDLLQLIKSAQNPPQKSAATIEQMPPMLQKLMLKEPGAAMSADELEKDLIKSAKPHRNHLLQ
EFTNSTSAISLAAVSTKPLHGSEGDVESDIAEGEILEPLDASFVVGSGEQTPVLNKEQFISAIAHLMQTDDEFVSQIHQA
YVSALNRRLNID
Estimated Isoelectric Point:
5.86913299560547
Estimated Molecular Weight:
36.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys23
Gln25
Leu32
Gly9
Met8
Ser24
Tyr7
His9
Glu19
Arg10
Cys1
Phe13
Pro22
Val11
Asn15
Ala49
Ile22
Trp2
Asp20